KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_06750Help
Entry
ERGA_CDS_06750    CDS       T00232                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:erg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070844..1071368
Genome map
AA seq 174 aa AA seqDB search
MAYSPGNDIVVLALGSNCGSMLLNIKSAINMLPLYNKTYSYIYKSMALLPENASSDWDTP
FLNMVVSGYTNLSPNLMLERVKYIEKKIGRFNNEYWSPRCIDIDIILWGDKVLDSQTLSI
PHKHMQDRDFVLVPLSDIHARFPHPVSKLSIEEIVLNLREINLIKQSYTITRYL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcttactcacctggcaatgatatagtagtactagcattaggtagtaattgtggcagt
atgttattgaatattaaatctgctataaatatgttacctttatataacaaaacatattct
tatatctataaaagcatggcactattaccagaaaatgctagtagtgattgggatactcct
tttctgaatatggtagtatcaggttatacaaatctttcaccaaatcttatgttagaaaga
gttaaatacattgaaaaaaaaataggcaggtttaataatgaatactggtcacctagatgt
atagatattgacattatcttatggggagataaagtcttagattcacaaactttatctatt
cctcataagcatatgcaagatagagattttgtacttgtaccactctctgatattcacgca
agatttcctcacccagtatcaaagctatcaattgaagaaatagttctcaatctacgtgag
atcaatttaataaagcagtcatatactataactcgatatttatag

DBGET integrated database retrieval system