KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_07830Help
Entry
ERGA_CDS_07830    CDS       T00232                                 

Gene name
pdhA
Definition
pyruvate dehydrogenase E1 component, alpha subunit
Orthology
K00161  
pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:erg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:erg00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:erg00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:erg00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253556..1254545
Genome map
AA seq 329 aa AA seqDB search
MTTDHIHNLTKQQLINCYHDMLLIRRFEEKSGQLYGMGLIGGFCHLYIGQEAIAVGIQHS
IIEGDSIITSYRDHGFMLSSGTDPKYVMAELMGKSTGCSGGKGGSMHMFNIEKQFFGGHG
IVGAQVPIGTGIALANKYKKNNNVVFTCFGDGATNQGQVYEAFNMAALWKLPVVYVIENN
EYAMGTSVSRSSYITDLYKKGESFGIPGYQIDGMDLFAVIKAATDAAAYCREQNGPILLE
MKTYRYRGHSMSDPAKYRSKEEVEKVKEEKDPLINLKNYMISNKIISEEDCNKYDKEIRN
IVKESVEFSQNSSEPAVNTLYTDVYKNTD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaccatatacacaacttgacaaagcaacaactaataaattgctatcatgac
atgttgctaatacgcagattcgaagaaaaatctggacagttatatggaatggggcttata
ggtggattctgtcacctgtatataggccaggaagcaatagcagttggtatacaacattca
ataatagaaggagattctatcattactagttatagagatcatggttttatgctttcttct
ggtaccgatccaaaatatgtaatggcagaacttatgggcaaaagtaccggatgttcagga
ggtaaaggtggctctatgcatatgttcaacatagaaaaacaattctttggaggacatggt
atcgtaggtgcacaagttcctataggtacaggaattgctcttgctaacaaatacaaaaaa
aataacaacgtggtttttacatgctttggagatggagctactaaccaaggacaagtatat
gaagcttttaatatggctgcactctggaaattaccagtagtatatgttattgagaataat
gaatatgcaatgggtacatcagtatctagatcatcttatattacagatttatataaaaaa
ggagaaagttttggtataccaggatatcaaatagatggaatggatttatttgcagtaata
aaagcagcaactgatgcagcagcttattgcagagaacaaaacggacctattttattagag
atgaagacataccgctacagaggacattctatgtcagatccagcaaaatatagatcaaaa
gaagaagtggaaaaagtgaaagaagaaaaagacccattgataaacttaaaaaattatatg
atatccaacaaaatcatatccgaagaggattgcaataaatatgataaagaaattcgcaat
atcgtaaaagaatctgtagaattttctcaaaacagtagcgaaccagcagtaaatacatta
tatactgatgtatataaaaacacagattaa

DBGET integrated database retrieval system