KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_08590Help
Entry
ERGA_CDS_08590    CDS       T00232                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase subunit
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:erg01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:erg00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:erg00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1375050..1376258)
Genome map
AA seq 402 aa AA seqDB search
MSEVQIRAENLGGESILEAPIRVSVKIGDSIKQGDVLFIIETDKTSLEIVSPVDGTVSKV
FIADEEIIERDQLLCTINVGELSHIVQSQTQDPKTDNGNIINDDIQAFIQKKDAPSAVKI
MAENSIDKNQINGSGIGGRITKSDVLDHINVVSKDHSVLSEQCSITSHEKREERVKMSKI
RQVIAARLKESQNTAAILTTFNEVDMKNVMDLRVQYRETFEKKYGVKLGFMSFFIKAVVL
ALKELPVINAEISGNEIIYKHYYDIGIAVGTDKGLVVPVMRDADKMSCAELELTLASLGK
KAREGKLEVSDMAGATFTITNGGVYGSLLSTPIINPPQSGILGMHSIQKRPVVVNDNSIE
IRPMMYIALSYDHRIVDGQGAVTFLVRVKQYIEDPSRMFLEI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtacaaataagggctgaaaatcttggtggtgagtcaatattagaagctcca
attcgagtttctgttaagattggtgatagtattaagcaaggtgatgtattgtttatcatt
gaaacggataaaacttctctcgaaattgtatctcctgtagatggaacagttagtaaagta
tttatagcagatgaagaaattatagaacgtgatcaacttttatgtacaataaatgttggt
gaattatcacatattgtccagtctcaaactcaggatcctaaaacagataatggtaatatt
attaatgatgatattcaggcgtttatacagaaaaaagatgctccttctgcagtaaaaatt
atggcagaaaattcaattgataagaatcagatcaatgggtctggtattggtggaagaatt
acaaaatctgatgttttagaccacattaatgttgtttcaaaagatcatagtgtgctttcc
gaacaatgtagtattacttctcatgagaagagagaagaacgtgttaagatgagtaaaatt
aggcaggtgattgctgcgagacttaaggagtctcaaaatactgctgcaatattaactacg
tttaatgaagtggatatgaagaatgttatggatcttcgtgttcagtatagggagaccttt
gaaaaaaaatatggtgtcaaacttggatttatgtctttttttataaaagcggtagtatta
gcattaaaagaattaccagtaattaatgctgagatatctggtaatgagattatatataaa
cattattatgatataggtattgctgtagggacagacaaaggtctagttgttccagtaatg
cgtgatgctgataagatgtcttgtgctgagcttgagttaaccttagcttctttaggtaag
aaagctagggaagggaaattagaagtttcagatatggctggtgcaacttttactattact
aatggtggagtatatggttcattattatctactcctataattaatcctcctcagtctggt
attttaggtatgcactctatacaaaaacgaccagtagtagttaatgataattctatagag
attagacctatgatgtacattgcattatcttatgatcatagaattgttgatggacaaggt
gctgtaacatttttagtaagagttaaacagtatattgaagatccaagtagaatgtttcta
gaaatataa

DBGET integrated database retrieval system