KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0015Help
Entry
ERH_0015          CDS       T01525                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:erh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18299..18889
Genome map
AA seq 196 aa AA seqDB search
MYPKKLEQLIESFMMLPGVGQKTAERYALSILDQQTQDVDKFSQDLTIARNEIQSCKVCH
NLSDEEICQICKDNTRDRSIICVVATAKEAFSIEKMNEYHGVYHVLGGLISTQKGILPEN
LNILSLINRVDENVTEVILALNATVEGEMTSLYLAKKLEEKTDVSRLAFGLPIGGHLDYA
DDMTLMKAFEGRSKVK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccaaaaaacttgaacaattaattgagtcgtttatgatgcttccaggagttgga
caaaaaacggctgagcgctatgcattaagtatcttggatcaacaaacacaagatgttgat
aaattttcacaagatctaaccatcgcacggaatgagattcaatcatgtaaggtatgtcac
aacctctcagacgaggaaatttgtcagatatgcaaagataacacacgtgatcgttccata
atatgtgtggttgctactgcaaaagaagcattctcaatcgaaaaaatgaatgaataccat
ggtgtctatcatgtattaggaggattaatctctactcagaaagggatacttcctgagaat
ttaaatatattatctctcattaatcgtgtcgatgaaaatgttactgaagttattttggcg
cttaatgctacagttgaaggcgaaatgacatccctctatcttgccaaaaaactagaggaa
aagacagatgtttcacgtttagcatttggtttaccaataggtggacatttagattatgct
gacgatatgacactaatgaaagcttttgagggtcgaagtaaagtcaaatag

DBGET integrated database retrieval system