KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0195Help
Entry
ERH_0195          CDS       T01525                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:erh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223597..225087
Genome map
AA seq 496 aa AA seqDB search
MKNYIITLDQGTTSSRAIIFDKESNIIAKAQTETTQIYPKQGWVEQDPMEIWATQSGVLN
EVLARAGIGPEEIETIGITNQRETTVVWNKNTGRPIYNAIVWQCRRTASICEDLKQQGLS
DYIKKNTGLIIDAYFSGTKVKWILDHVEGARDQADRGELMFGTVDSWLLYNLTGGKVHAT
DYTNASRTLLYNIKRLEWDQTILKALDIPMNMLPKVFDSSHLYGYTNIQGYQIPISSVVG
DQQAALFGQTCFNSGDVKNTYGTGCFLLMNTKEQFVESENGLLTTIAIGLDGKIEYALEG
SVFIAGAVIQWLRDELGIIDDASDVEYFAQKVRDCGGVYFVPALTGLGAPYWDMDATGTI
FGLTRGTNKNHIIRAALESIAFQSYDIMKAMEEDSKIKIKSLKVDGGASSNNFLMQFQAD
LLDVNVQRSFTPESTSLGACFLAGLQTGFFKNKEKLIDVRTKNTSWDSKISDDERFKKLS
EWHRAIEKTLTQKHTQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactatattattacacttgatcaaggaactacaagttcacgcgctattattttc
gataaagaatctaacattattgcgaaagcacagacggagacaacccagatctatccaaaa
caaggatgggtagaacaagaccctatggaaatctgggcaactcaaagtggtgttcttaat
gaagtcttagctcgggcagggataggtccagaggaaattgagacgattggcattacaaac
caacgtgaaaccactgtcgtatggaataaaaatacaggacgtccaatttataatgcgatt
gtctggcaatgtcgtcgtacggcatccatttgtgaagatttaaaacaacaaggattatca
gactatatcaagaagaatacaggattaattattgacgcctatttttcaggaacaaaagtg
aagtggattctagatcatgttgagggtgctcgagatcaagcggatcgtggcgagttgatg
tttgggactgtagattcatggttactttacaatctaacaggcggtaaagttcatgcaaca
gactataccaatgcctcaagaaccctgttatacaatatcaagcgtttagagtgggatcag
accatcttaaaagcattggatattccaatgaacatgttgccaaaggtgttcgatagcagc
catttgtatggctataccaatattcaaggatatcaaattccaatctcaagtgttgtcgga
gatcaacaagctgctttatttggtcaaacatgtttcaattcaggtgatgtaaagaatacg
tatggtactggatgctttctgctcatgaatactaaagaacaatttgttgagagtgagaat
ggtcttctcactacgattgcgattggtttagatggaaagattgaatatgcattagaaggg
tcggtatttatagcaggagctgttatacagtggttacgagacgaactggggattattgac
gatgcttctgatgtagagtatttcgcacagaaagttcgtgattgcggaggtgtctatttc
gttccggcacttacgggattaggcgcgccctattgggatatggatgcgactggcacaata
tttggattaacacgaggaacaaacaaaaatcatatcattcgagcagcattagaatccata
gcattccaaagctacgatatcatgaaagccatggaggaagattctaaaattaaaatcaaa
tctttaaaagtagatggtggcgcatcaagcaataatttcttgatgcaatttcaagctgac
cttctagatgtgaatgttcaacggtcctttaccccagagtctacatcgttaggtgcatgt
ttcttagcgggattacaaactggattttttaagaataaagaaaaactcattgatgttcgt
accaaaaatacatcttgggattcaaaaattagcgatgatgagcgatttaaaaaattatcg
gagtggcatcgagcaatagaaaaaacattaacacaaaaacacacgcagtag

DBGET integrated database retrieval system