KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0224Help
Entry
ERH_0224          CDS       T01525                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:erh00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:erh00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259323..260549
Genome map
AA seq 408 aa AA seqDB search
MDTQRLIKKAQALYPNTDLDITKIQLNQHVLENYGFDGYQIHYDDDLIIIASNTERGHFY
GLLDVFSGNPSTTLNKAKVEERGLHVDMGRKFFSEAWFMDTIELMARLKLNTLQMHFSEH
LGFSIESKRFPQIVSREHLSQDAVRRIIKHANDYYIDVIPSFDSPGHLQVVLEAYPEYLM
ENTTMGLDITNPKARSFIKEIYDEMDDLFHTSTSFHMGADEFIDFGKYDEFPKLEAYAKE
HFGPNAKGFDTFVDYVNDIASHIQGRGKTVRAWNDGLYRIDQEPTIILNKDIIITYWTSW
NPKMAPVQTFVDRGHNVVNYMDSLLYFVLGENAGYTYPTETSIMTSFEPDRFPNRHETCE
GNLEQRSKTLGAMFSIWCDKPEALTAEEVALKIQDPLRAFALKCWHEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggacacacagagattaattaaaaaagcacaagcactttatccgaatacagatttggat
ataacgaagatacaacttaaccaacatgtactcgaaaattatgggtttgatggatatcaa
attcattatgatgatgatttaatcattattgcctcaaatactgaacgtggccatttctat
ggtctcttggatgttttttcaggcaatccttccacaacacttaataaggcaaaggtagaa
gagcgtggcttacatgtggatatgggccgtaaattttttagtgaagcgtggtttatggac
acgattgaattgatggcacgccttaagctaaataccttgcagatgcatttttcagaacat
ttaggctttagtattgaatcgaaacgttttccacaaattgtatctcgagaacatctaagt
caagacgctgtaagacgaatcatcaagcatgctaatgattattatatcgatgttattcca
tcatttgattcacccggtcatcttcaggttgtattagaagcttacccagaatatctcatg
gaaaacacaacgatgggccttgatattaccaatccaaaagcacgttcatttattaaagaa
atttacgatgagatggatgatttattccacacatccacaagttttcacatgggagcagat
gaatttatcgattttggaaaatacgatgagttccctaaacttgaggcgtatgcgaaggaa
cacttcggtccaaatgcgaaaggctttgatacattcgtagattatgtcaatgatatcgca
tcccacatccaaggtagaggtaagaccgttcgcgcttggaatgacggtttatatcgcatc
gatcaagaaccaacaataatccttaacaaagacatcatcattacctattggaccagttgg
aatccaaagatggcaccggttcaaacctttgtggatcgaggccataatgtggtgaattat
atggatagtttactgtattttgttttaggagaaaatgcagggtatacatatccaacagaa
acatccatcatgacatcctttgaacccgatcgttttccaaaccgtcatgagacctgtgaa
ggtaatttagaacaacgttcaaaaacactgggtgcaatgttttcgatttggtgtgataaa
ccagaagcattaacggcagaagaagtagcattaaaaattcaagatccactgcgtgcattt
gctttaaaatgctggcatgaaaactaa

DBGET integrated database retrieval system