KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0237Help
Entry
ERH_0237          CDS       T01525                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:erh00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
276838..278229
Genome map
AA seq 463 aa AA seqDB search
MKPTDDLKLPKDFWFGAAASAPQTEGASDVDGKSPSTWDMWHRLEPERFDLEMGPNQTSD
VYHHYRDDVKRMQAMKLNSYRTSIAWTRLLPDGKTLNPKAVAFYRDYFKTMRDGGIEPVI
NLFHFDMPWWLMEKGGWEYEGVSDAFAYYASVCVETFGDLVTYWTTFNEPIVHVECSYLY
GYHYPAIHDFKKAIYAGYQTILAHAKAIEAMRTVNPKLKLGTILNLTPVYGKSDQIADVK
AREAADLLNTKSFLDGMVLGTFSEPLLDLLREQDLMPDTNAEDLKIISNVSLDFIGVNYY
QPRRVKAPTTSKTPAQDPEDLYIPYLWPDRKMNPYRGWEIYPEALSDIATLIKDSYHNIP
WYLSENGMGVADEMRFVDENGTIQDDYRIEFIYDHLKVLEQAIADGANCFGYHLWTFVDC
WSWLNGYRNRYGFYRIDLKTQKRYAKQSSYWMRDLISYHQKGE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaactgatgatttaaaactgcctaaagatttttggtttggcgcggctgcatct
gctcctcaaacagaaggtgcttcagatgtagatggaaaaagcccaagcacctgggacatg
tggcacagattagaaccagaacgctttgatcttgaaatgggcccaaatcaaaccagtgat
gtctaccatcattaccgtgacgatgtgaaacgtatgcaagcgatgaaacttaattcatac
cgtacttccatagcatggacgcgtcttttgccagatggtaaaacgttgaatccgaaagcc
gtcgcattttatcgagactatttcaagacaatgcgagatggaggcattgaaccagtcatc
aatctctttcactttgatatgccttggtggctcatggaaaaaggcggatgggaatatgaa
ggtgtcagtgatgcatttgcttattatgcttcggtatgcgtagaaacctttggagatttg
gtgacgtattggacgacatttaatgaaccgattgttcatgtggagtgcagttatctgtat
ggatatcattatcccgcaatccatgattttaaaaaggcaatctacgcaggatatcaaacg
attttagcgcacgctaaagcaattgaagcaatgcgtactgtaaatccaaaattgaaactg
ggtacaatccttaatttaacgcctgtctatggtaaaagtgatcaaatagcggatgtgaaa
gcacgagaagcagcggatttactgaatactaagagctttcttgacggcatggtgcttgga
acgttttcagaacccctgcttgatttactacgcgaacaagatttaatgccggatacaaac
gctgaagatctaaaaattatttcaaacgttagccttgattttattggtgttaattattat
caaccgcgtcgcgttaaagcaccaacgacttcaaaaacacctgcacaagatccggaagat
ctctacattccgtatctatggccagaccgtaaaatgaatccttatcgtggttgggagatc
tatccagaagccttaagtgatatagcgacacttattaaagactcgtaccataatatccca
tggtatttatctgaaaatggaatgggtgttgcggatgaaatgcgatttgttgatgaaaac
ggaacgattcaagacgattatcgtattgagtttatttacgatcacctcaaggtcttagaa
caggctattgctgatggtgcgaattgttttggataccatctatggacctttgtggactgt
tggtcttggcttaacggatatcgaaatcgttatggattttatcgcattgatttaaaaacg
cagaaacgatacgcaaaacaaagtagttattggatgcgtgatctgatttcataccatcaa
aagggggagtaa

DBGET integrated database retrieval system