KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0355Help
Entry
ERH_0355          CDS       T01525                                 

Gene name
nrdF
Definition
ribonucleoside-diphosphate reductase subunit beta
Orthology
K00526  
ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:erh00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:erh00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
389884..390960
Genome map
AA seq 358 aa AA seqDB search
MMLKQINEIKANREYDGANWNEHEDNFTQTFYEQNLSQFWRPEDISLQPDLNLWASLSED
VKLAYGRNLLVLTFLDTYQGDIGMPVVSRSIDHKYHQRKSVLNFMAAMENAVHAKSYSNI
FMTYMKNEEIDDLYRWGEQNKNMQNILALIIGYYENLDRLTYRKQYADLGEPVDDFEFDV
AQWKAMVASVFLESCLFYSGFYYPLYFYGQGKLMQAGEIINLILRDESIHGLYIGNLAME
LYRKFDAETQASLYEWLTTYLDAIYEEEVELIEAIYDPVELSHDVKIFVRYNANKAMMNL
GFDAYYEYEEVNPVVLNGLNTETKTMDNFSMKGNGYQKMKSESLHDDDFFFDKERIAR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgaagcaaattaatgagatcaaagcaaatcgtgaatatgatggtgcgaattgg
aatgaacatgaagataattttacacaaacgttttacgaacaaaatttaagtcagttttgg
agacctgaagatatcagtcttcagccagatctaaatctatgggcaagcttgtctgaagat
gtgaaactggcatacggccgaaacttattagtacttaccttcttagatacctatcaaggg
gatatcggaatgccggtagtgtcgcgttcgattgaccacaagtatcatcaacgtaagtct
gtattgaactttatggctgccatggaaaatgcagttcatgcgaaaagttattcaaatatt
tttatgacctatatgaaaaatgaagaaattgatgatctttaccgttggggtgaacaaaat
aagaatatgcaaaatattctcgcattaatcattggttattatgaaaatctggaccgtctt
acttatcgtaagcaatatgctgatttaggcgaacccgtggatgattttgagtttgatgta
gcacaatggaaagcgatggttgcaagtgtattcttggagtcatgtcttttctatagtggt
ttctattatccgctttatttctatggtcaagggaagttgatgcaagcaggtgaaattatt
aatctgattttacgtgatgagagtatccatggactttacattgggaacttagcgatggaa
ttgtatcgcaagtttgatgcggaaacacaagcatcactttatgaatggcttacaacctat
cttgatgcaatctatgaggaagaagtagagctgattgaagcaatttacgatccggtagag
ttatcacacgacgttaagatctttgttcgttataatgcgaataaagcaatgatgaatctt
ggttttgatgcatactatgaatatgaagaagtaaacccagttgtgcttaatgggttaaat
acagaaacaaaaactatggataatttctccatgaaaggaaatggttatcagaaaatgaaa
tcagagtcattacatgatgatgacttcttctttgataaagaaaggattgcacgataa

DBGET integrated database retrieval system