KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0440Help
Entry
ERH_0440          CDS       T01525                                 

Gene name
pdhC.1
Definition
pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ERH_0440 (pdhC.1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERH_0440 (pdhC.1)
   00020 Citrate cycle (TCA cycle)
    ERH_0440 (pdhC.1)
   00620 Pyruvate metabolism
    ERH_0440 (pdhC.1)
Enzymes [BR:erh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ERH_0440 (pdhC.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
478491..480071
Genome map
AA seq 526 aa AA seqDB search
MSFIFKMPDVGEGIAEGEIVSWFVKEGDTIKEDEPLLEVQNDKLVQEIPSPVAGTITKIM
VAPGTVATVGDDLVEIVAEGAVASAPAKEETAAPAPAAAAGSFVFNMPDVGEGIAEGEIV
QWFVKVGDDIKEDAPLLEVQNDKLVQEIPSPVSGKVMNIMIEAGTVATVGQPLVEFAAEG
HAPAAAPAQAAPVAAASQQASGNGETFAQNKIAGRVLAMPSVRQFARENNIDLTLVTATG
KHGHIRKSDVEAFIAGGATAPVVEAPVVEATTSVEAAPVAKPAAKPAPVVVTGSTTREKM
TPTRKAISKAMVTSKATAPHVTLFDEVDVTELVNHRKKFKEIAAAQDVKLTFLPYIVKAL
TAVVRKYPILNSSVDDSTQEIVYKNFINIGFAADTPHGLYVPNIKNADSKGIFTVAKEIS
TLAAAANDNTLAGADMRDGSITISNIGSARGLWFTPIINYPEVAILGVGRIDKKPVVLAD
GTIGVGNMLALSLSFDHRIIDGALAQNAMNELKRLLNNPELLLMES
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttatatttaaaatgcctgacgtaggtgaaggaattgctgaaggagaaatcgtt
agttggttcgttaaagaaggcgacacaattaaagaagatgaacctctattagaagttcaa
aacgataaacttgttcaagaaattccatccccagtagcaggaacaattacaaaaattatg
gtcgcaccaggaactgtagcaacagttggtgacgatctcgtagaaatcgtagcagaaggc
gcagttgcatctgcacctgctaaagaagaaacagcagcacctgcacccgcagcagctgca
ggatcatttgtattcaatatgccagatgttggtgaaggtatcgctgaaggtgaaattgta
caatggttcgtaaaagttggtgatgacattaaagaagatgcaccactattagaagttcaa
aacgataaacttgttcaagaaattccatccccagtatcaggtaaagtcatgaatatcatg
atcgaagccggtacagtggcaacagttggacaaccacttgttgagtttgcggcagaagga
catgctccagcagcagctcctgcccaagcagcacctgttgcagcagcaagccaacaagct
tcaggaaacggcgaaactttcgcacagaataaaattgcaggacgcgttctcgcaatgcca
tctgttcgtcaatttgctcgcgaaaataacattgatttaacacttgttacagcaacaggt
aaacacggtcatatccgtaaatcagatgttgaagcatttatcgcaggcggcgcaactgca
ccagtagttgaagcaccagtagttgaagcaacgacatccgttgaagcagcaccagtagca
aaaccagcagcaaaaccagctccagttgttgttacaggatctactacacgtgaaaaaatg
actccaactcgtaaagcaatttcaaaagctatggttacaagtaaagcaacagcaccacac
gttacattatttgacgaagttgatgttacagaacttgtaaatcaccgtaagaaatttaaa
gaaattgcagcagcacaagatgttaaattaacattcttaccttatattgttaaggcatta
actgcagtagtacgtaaatatccaatcttaaattcaagtgttgatgattcaacacaagaa
attgtttacaaaaacttcattaacatcggttttgcagcagatacacctcacggtttatat
gttccaaatatcaaaaatgctgattcaaaaggtatctttacagtagctaaagaaatctca
acattggcagccgcagcaaatgataatacattagctggagcagatatgcgcgatggttca
attacaattagtaatattggatcagcacgtggactctggtttacaccgatcatcaactac
ccagaagtagcgatcttaggtgtaggacgtattgataagaaaccagttgttctagcagat
ggaacaatcggcgttggaaatatgttagcattatcattaagcttcgaccaccgtattatc
gatggtgccctagcacaaaatgccatgaacgaactcaagagattgttaaacaatcctgag
cttctattaatggaatcttaa

DBGET integrated database retrieval system