KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0457Help
Entry
ERH_0457          CDS       T01525                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ERH_0457 (gpmA)
   01230 Biosynthesis of amino acids
    ERH_0457 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERH_0457 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ERH_0457 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ERH_0457 (gpmA)
Enzymes [BR:erh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ERH_0457 (gpmA)
Exosome [BR:erh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ERH_0457 (gpmA)
  Exosomal proteins of melanoma cells
   ERH_0457 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(500086..500835)
Genome map
AA seq 249 aa AA seqDB search
MMKLVVVRHGESEWNEKNLFTGWADVELSEKGVEEAKLGGRMLKEEGYDFDIVYTSYLKR
AIHTMDNILNEMERTWLPIVKDWRLNERHYGALQGLDKAETAAKYGEDQVLIWRRSFDVK
PPELDPTDERAPRNMEAYRNVEDKDILPLHESLKETIERAVPYFEETIKPQMLDGKRVLI
VAHGNSLRSLVKYFDNMTDDEIMKVNIPTGVPLVYEFDNDFNVVNKYYLGDQEALKAKME
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagttgtagttcgtcacggtgaaagtgaatggaacgaaaagaacctcttt
actggatgggctgatgtagaactttcagaaaaaggtgtagaagaagctaaacttggtgga
cgtatgcttaaagaagaaggttacgatttcgatatcgtttatacttcatacttaaaacgt
gcaatccacactatggacaatattttaaatgaaatggaacgtacatggttaccaatcgtt
aaagattggagacttaacgaacgtcactacggtgcgttacaaggtttagataaagctgaa
acagctgcgaaatatggtgaagaccaagttcttatttggagacgttcatttgacgttaaa
cctccagaattagatcctactgacgaacgtgctccacgtaacatggaagcataccgtaat
gtagaagataaagatatcttaccattacacgaatccttaaaagaaacaattgaacgtgct
gttccttattttgaagaaacaattaaacctcaaatgttagatggaaaacgtgttcttatt
gttgctcatggtaactcattacgttcacttgttaaatattttgacaatatgactgatgat
gaaattatgaaggtaaacatccctacaggtgttcctttggtttatgaatttgataacgac
ttcaatgttgtaaacaaatactacctcggtgaccaagaagcacttaaagctaaaatggaa
gcagtcgcaaaccaaggaaaagctaaataa

DBGET integrated database retrieval system