KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0677Help
Entry
ERH_0677          CDS       T01525                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:erh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ERH_0677
Enzymes [BR:erh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ERH_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
716553..718688
Genome map
AA seq 711 aa AA seqDB search
MEQTIKGSVETCIFKNEQSGYGIFRIVLFNSNQKPMTIKGPLATLELDSFYEFTGDYVED
PRYGMQFDVIAFKQMLPQHRDFIIRFLSGPNFPGIGQKTATAVVDTYGEDVLDQIREDES
FKLEVKGITAAKAEMIVSVIRKQDAQEDAVSFLLAHGLGNKQIIKITKEYGDNAISVIRE
NPYRLVYDVDGIGFKTADKVAMSLGYALDNPLRVEALVLDRYKTICFGAGDSFITKDKLF
DGVRMGDAERVESAYQALVQSGELVEDGDRLYHRTQYDSEVYVTQTLKDFKYSGYDFDLD
DLESKIASIESQLRIEFDDTQREAIESFLREDVMILTGGPGTGKSTLLSGVVTLLQANCP
WLHITLCAPTGRAAKRLEELTNVQAATIHSVLKWDLESNKFGMHEENPLETDILIIDEFS
MVDTWLLAHILKASEKVKKLLFVGDKDQLPSVSSGFVLGDLIASKVFKTISLERNYRQEA
GSEVIDLAVNMNQGLLDVSNYHRDVRFFDSRYGSVKDIVLKVVDEAMQRGYDLSDIQVLA
PMYSGPAGIDNLNHFLQKMCNPESPQKAQIMYGTRIFREGDKILQLKNQPDDFVFNGDIG
MLVEVEAKRLVVDFDGNFVEYEPSSYINITHAYAMSVHKAQGSEYPIVILVAVRDFYRML
SRRLYYTGATRSSKSLVLVGELEAFNTAVENHHEAKRNTYLTERLQEAFEK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacgattaaaggatctgtcgaaacatgtatatttaaaaatgaacaatctgga
tatggtattttccggattgttcttttcaatagcaatcaaaaaccgatgaccattaagggc
cctttagcgactttagagctggattcgttttatgagtttacaggggattacgttgaagat
ccacgttatggcatgcagtttgatgtcattgcctttaaacaaatgcttccccaacaccgt
gatttcattattcgttttttaagtggacccaattttccgggtattggccaaaaaacggca
accgcagttgtggatacctatggcgaagatgtattagatcaaattcgtgaagatgagtcc
tttaaacttgaagttaagggaatcactgcagcaaaagcggaaatgattgtttcagtgatt
cgaaaacaagatgcgcaagaagatgcggtatcgtttttgcttgcccatggacttgggaat
aagcaaattattaaaataaccaaagaatatggtgataatgcgatttcagtaattcgtgaa
aatccttatcgtcttgtttatgacgtcgatggtattggatttaaaacggccgataaagtc
gcaatgtcgcttggctatgcacttgataatcctttgcgtgttgaggcactggttcttgac
cgttataaaacaatttgttttggggctggcgacagttttataaccaaagacaaattgttt
gatggggtacgaatgggcgatgcagagcgtgttgaatcggcgtatcaagctctggttcaa
agcggtgaattggttgaagatggtgaccgtctttaccaccgtacacaatatgatagtgaa
gtttatgttacccaaacccttaaggattttaaatactcaggttatgattttgatttggat
gatttggaatctaaaattgcatcgattgaatcacagttacgcattgaatttgatgatacc
caacgtgaagccattgagtcctttttacgtgaagatgtcatgattttaaccggtggaccg
ggaacggggaaaagtaccttgctttcaggtgtggtcacattactccaagcaaattgtccc
tggctacacattaccttgtgtgcgccgactggacgtgccgcaaaacgcttggaagaatta
accaacgtccaagcggctacgattcactctgtacttaaatgggatttggaatccaataag
tttggtatgcatgaagaaaacccattagaaaccgatattttaattatcgatgagttttca
atggtggatacatggcttcttgctcatatcttaaaagcatcggagaaggtaaaaaaactg
ctgtttgtgggtgataaagatcagcttccatcagtgagcagtggttttgtattgggggat
ttaattgcatcaaaggtatttaaaacaatttcattagaacgaaactaccgtcaagaggct
ggatctgaagttatcgacttagccgtcaatatgaatcaaggtcttctggatgtttcaaat
tatcatcgtgatgtccgtttctttgatagccgttatggcagtgtcaaagatattgtctta
aaggttgtggatgaagccatgcaacgtggttatgatttaagcgatattcaagtcttagca
cccatgtactcgggaccggctgggattgataatttaaatcacttccttcaaaaaatgtgt
aatcctgagagtcctcaaaaagcgcagattatgtatgggacgcgtatttttagggaaggg
gataaaatccttcaacttaaaaatcaaccggatgattttgtatttaatggggatattggg
atgcttgtggaagttgaagccaaacgtttggtcgttgattttgacggaaacttcgtcgag
tatgagccatcttcctatataaacattacgcatgcttatgcgatgagtgttcataaagca
caaggatcggaatatcccattgtgattcttgtagcggtgcgggatttttaccgcatgtta
tcacgtcgtctttactataccggagcaacgcgctcttcaaaatcactagtcttagtgggt
gaattggaagcctttaatactgcggttgaaaatcaccatgaagccaaacgcaatacatac
ttaaccgaacgtttgcaagaagcatttgaaaagtaa

DBGET integrated database retrieval system