KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_1009Help
Entry
ERH_1009          CDS       T01525                                 

Gene name
glk.2
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ERH_1009 (glk.2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERH_1009 (glk.2)
   00052 Galactose metabolism
    ERH_1009 (glk.2)
   00500 Starch and sucrose metabolism
    ERH_1009 (glk.2)
   00520 Amino sugar and nucleotide sugar metabolism
    ERH_1009 (glk.2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ERH_1009 (glk.2)
   00524 Butirosin and neomycin biosynthesis
    ERH_1009 (glk.2)
Enzymes [BR:erh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ERH_1009 (glk.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1067055..1067969)
Genome map
AA seq 304 aa AA seqDB search
MNKYIGVDLGGTNVRVAVIDEDGKIHEQVKSESYALEGPEVVLDNIISMIKNLKQFDECV
GIGLGLPGPVNTELGCVTLSTNMKGFTEYPVIDYLKKHIDLPIYMDNDANVAGLAEALVG
AGKGNNVVYYLTHSTGIGGALVFNGQVLSGHKGYAGEVGNIVIDRERVRRSDINTLNAGA
VENEASGSALVRKAQELIDPKIQSAEEIFTLMEQGNEQAIQLIDEMSYDFAMMLSSIAHV
CNPHVFVIGGGVTKSKNLYWDRMIGYYQELVHEQMRDTQFVEAKLDEPGVIGAAMLCYSK
EGHR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatatatcggagttgatttaggcggtacaaatgtacgtgtggctgttattgat
gaagatggaaagattcatgagcaagttaagagcgaatcatacgcacttgagggacctgaa
gttgttttagataatatcatttcgatgataaaaaatttaaagcaatttgatgaatgtgtt
ggaattggactgggtttacccggtccagtgaacacagaactcgggtgcgtaaccttatct
acaaacatgaaagggtttacggagtatccggtaatcgattatctcaaaaagcatatagat
ttaccaatctatatggataatgatgcaaacgttgcaggtcttgctgaagcactcgttggt
gcaggtaaaggcaataatgttgtgtattatttaacgcattctacaggtattgggggagca
cttgtatttaatggacaagtgctttctggtcacaaggggtatgcgggggaagtcggtaat
atcgtgattgatcgtgaacgtgttcgacggtcggacattaatactttaaatgcgggtgcg
gttgaaaatgaagcaagtggttcggcattagttcgtaaagctcaagaattgattgatcca
aagattcagtctgcagaagaaattttcactttaatggaacaaggaaatgaacaggcaatt
caactaattgatgaaatgtcctacgatttcgctatgatgctctcttcaattgcgcatgta
tgtaatccacatgtttttgtaattggtggtggtgttacgaaatcaaaaaacttatattgg
gaccgtatgatcggttattatcaggaactcgttcatgaacaaatgagagatacacaattt
gttgaagcgaagttggatgaacctggtgtaattggtgcggcgatgttgtgttactcgaaa
gaaggtcacagataa

DBGET integrated database retrieval system