KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_1051Help
Entry
ERH_1051          CDS       T01525                                 

Definition
putative 6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ERH_1051
   01230 Biosynthesis of amino acids
    ERH_1051
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERH_1051
   00030 Pentose phosphate pathway
    ERH_1051
   00051 Fructose and mannose metabolism
    ERH_1051
   00052 Galactose metabolism
    ERH_1051
  Energy metabolism
   00680 Methane metabolism
    ERH_1051
Enzymes [BR:erh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ERH_1051
Protein phosphatases and associated proteins [BR:erh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ERH_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1108627..1109838)
Genome map
AA seq 403 aa AA seqDB search
MAKCLVAQSGGPTSVINATVAGIVKANQLNPIYDVVLGGLHGIEGILEEKFVDLTHMSED
ENNVLRQTPSSALGSCRYKLKRENVADFEKLFAILEKHDIRTMFYVGGNDSMDTVYALSQ
YAEANGHTEFQFVGCPKTVDNDLMVIDHCPGFASAAKFIATTAYQTWLDSTVYTRQDVFI
LETMGRDAGWLAASACVSGVVDMVVLPELPFDKEAFLKTVQKHIDEKNKCYIVVSEGVRY
EDGTYLAAGESKNDTFGHAVLGGAGNALRELILEAGISERAKVQDLSNAQRSHATEQSKV
DVEESFKLGMSAHMRSMEPSFTGKMVALKRVEGVEEYDVEFFATDASNVANHVKNFPIEW
ILPEFAGIAQEAHDYIAPLLVGRPVVMFDEKGLPRQVKPFYMR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatgtttagtggctcaatcaggtgggccaacatcagtaattaacgctactgtt
gcaggtatcgttaaagcaaaccaactgaacccaatttatgatgtggttttaggtggtctt
catggaatcgagggaattcttgaagaaaaatttgtggatttaacacacatgagtgaagac
gaaaacaatgttttacgtcaaacaccttcaagtgcattaggttcatgtcgttataaatta
aaacgtgaaaacgttgcagatttcgaaaaattattcgcaattttagaaaaacatgatatc
cgtacaatgttctacgttggtggaaacgactcaatggatacagtttatgcattatcacaa
tatgcagaagcaaatggacacactgaattccaattcgttggttgtccaaaaactgttgat
aatgaccttatggttatcgatcactgtccaggatttgcaagtgcagcgaaatttatcgct
acaactgcttaccaaacatggttagatagtactgtttatacacgtcaagatgtatttatt
cttgaaacaatgggacgcgatgctggttggttagcagcaagtgcttgtgtttcaggtgtt
gttgatatggtagttcttcctgaactaccgttcgataaagaagcatttttaaaaacagtt
caaaaacatattgatgaaaaaaataaatgttatatcgttgtaagtgaaggtgttcgttac
gaagacggaacttacttagcagcaggtgaatcaaaaaatgatacatttggtcatgcagtt
cttggtggagcaggaaatgctttacgtgaattaattcttgaagcaggtatttcagaacgt
gctaaagtacaagacttaagtaacgcgcaacgttcacatgctacagaacaatcaaaagta
gacgttgaagaatcattcaaacttggtatgtcagcacatatgcgttcaatggaaccatca
ttcacagggaaaatggttgcacttaaacgtgttgaaggtgttgaagaatatgatgttgaa
tttttcgcaacagacgcaagtaatgttgcaaaccatgttaagaatttcccaattgagtgg
atcttaccagaatttgcaggtattgctcaagaagctcacgactatatcgctcctctttta
gtaggacgtccagttgtaatgtttgacgaaaaaggattacctcgtcaagttaaacctttc
tacatgcgttaa

DBGET integrated database retrieval system