KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_1051Help
Entry
ERH_1051          CDS       T01525                                 

Definition
(GenBank) putative 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
erh00010  Glycolysis / Gluconeogenesis
erh00030  Pentose phosphate pathway
erh00051  Fructose and mannose metabolism
erh00052  Galactose metabolism
erh00680  Methane metabolism
erh01100  Metabolic pathways
erh01110  Biosynthesis of secondary metabolites
erh01120  Microbial metabolism in diverse environments
erh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERH_1051
   00030 Pentose phosphate pathway
    ERH_1051
   00051 Fructose and mannose metabolism
    ERH_1051
   00052 Galactose metabolism
    ERH_1051
  Energy metabolism
   00680 Methane metabolism
    ERH_1051
Enzymes [BR:erh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ERH_1051
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     ERH_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAK32106
UniProt: F5WTM4
Position
complement(1108627..1109838)
Genome map
AA seq 403 aa AA seqDB search
MAKCLVAQSGGPTSVINATVAGIVKANQLNPIYDVVLGGLHGIEGILEEKFVDLTHMSED
ENNVLRQTPSSALGSCRYKLKRENVADFEKLFAILEKHDIRTMFYVGGNDSMDTVYALSQ
YAEANGHTEFQFVGCPKTVDNDLMVIDHCPGFASAAKFIATTAYQTWLDSTVYTRQDVFI
LETMGRDAGWLAASACVSGVVDMVVLPELPFDKEAFLKTVQKHIDEKNKCYIVVSEGVRY
EDGTYLAAGESKNDTFGHAVLGGAGNALRELILEAGISERAKVQDLSNAQRSHATEQSKV
DVEESFKLGMSAHMRSMEPSFTGKMVALKRVEGVEEYDVEFFATDASNVANHVKNFPIEW
ILPEFAGIAQEAHDYIAPLLVGRPVVMFDEKGLPRQVKPFYMR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatgtttagtggctcaatcaggtgggccaacatcagtaattaacgctactgtt
gcaggtatcgttaaagcaaaccaactgaacccaatttatgatgtggttttaggtggtctt
catggaatcgagggaattcttgaagaaaaatttgtggatttaacacacatgagtgaagac
gaaaacaatgttttacgtcaaacaccttcaagtgcattaggttcatgtcgttataaatta
aaacgtgaaaacgttgcagatttcgaaaaattattcgcaattttagaaaaacatgatatc
cgtacaatgttctacgttggtggaaacgactcaatggatacagtttatgcattatcacaa
tatgcagaagcaaatggacacactgaattccaattcgttggttgtccaaaaactgttgat
aatgaccttatggttatcgatcactgtccaggatttgcaagtgcagcgaaatttatcgct
acaactgcttaccaaacatggttagatagtactgtttatacacgtcaagatgtatttatt
cttgaaacaatgggacgcgatgctggttggttagcagcaagtgcttgtgtttcaggtgtt
gttgatatggtagttcttcctgaactaccgttcgataaagaagcatttttaaaaacagtt
caaaaacatattgatgaaaaaaataaatgttatatcgttgtaagtgaaggtgttcgttac
gaagacggaacttacttagcagcaggtgaatcaaaaaatgatacatttggtcatgcagtt
cttggtggagcaggaaatgctttacgtgaattaattcttgaagcaggtatttcagaacgt
gctaaagtacaagacttaagtaacgcgcaacgttcacatgctacagaacaatcaaaagta
gacgttgaagaatcattcaaacttggtatgtcagcacatatgcgttcaatggaaccatca
ttcacagggaaaatggttgcacttaaacgtgttgaaggtgttgaagaatatgatgttgaa
tttttcgcaacagacgcaagtaatgttgcaaaccatgttaagaatttcccaattgagtgg
atcttaccagaatttgcaggtattgctcaagaagctcacgactatatcgctcctctttta
gtaggacgtccagttgtaatgtttgacgaaaaaggattacctcgtcaagttaaacctttc
tacatgcgttaa

DBGET integrated database retrieval system