KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_1335Help
Entry
ERH_1335          CDS       T01525                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ERH_1335 (tpiA)
   01230 Biosynthesis of amino acids
    ERH_1335 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERH_1335 (tpiA)
   00051 Fructose and mannose metabolism
    ERH_1335 (tpiA)
   00562 Inositol phosphate metabolism
    ERH_1335 (tpiA)
Enzymes [BR:erh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ERH_1335 (tpiA)
Exosome [BR:erh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ERH_1335 (tpiA)
  Exosomal proteins of bladder cancer cells
   ERH_1335 (tpiA)
  Exosomal proteins of melanoma cells
   ERH_1335 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1396850..1397593)
Genome map
AA seq 247 aa AA seqDB search
MRKPIIFGNWKMNKTIAEATEFVQGIDAFVTDKADFGVAVPFTALQASIANAKNLNIAAE
NVHWAANGAYTGEISVEMLKEIGTKWVVIGHSERRQYFNETDEDINKKAAVLIENGMTPI
VCVGETLFEFEADKTEKVVRKQVAGCLSGLNAEDVQNIVIAYEPVWAIGTGKSATVEIAQ
NTCALVRDEVKNLFGAEVSDKVRIQYGGSVKPENIEEYMSQEDIDGALIGGASLQVDSFK
AIIDAIK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgattatctttggtaactggaaaatgaataagacaattgcagaagcaact
gaattcgttcaaggtattgatgcatttgttacagataaagcagactttggtgttgccgtg
cctttcacagcattacaagcatccattgcaaatgctaaaaacttaaacattgcagctgaa
aatgttcactgggcagctaacggtgcttatacaggtgaaatctcagttgaaatgttaaaa
gaaattggcacaaaatgggttgttatcggacactcagaacgtcgtcaatatttcaatgaa
acagatgaagacatcaataaaaaagctgctgttttaatcgaaaatggtatgactccaatc
gtttgtgttggggaaacattgtttgaatttgaagcagataaaacagaaaaagttgttcgt
aaacaagttgcgggttgcttaagtggtttaaatgcagaagatgtacaaaacatcgtgatc
gcatacgaacctgtttgggcaattggaactggtaagagcgctactgttgagattgctcaa
aacacatgtgctttagttcgtgatgaagttaaaaacttatttggagcagaagtttctgat
aaagttcgtattcaatacggtggatcagttaaacctgaaaacattgaagaatacatgtca
caagaagacattgatggtgcattaattggtggagcttcacttcaagtggattcattcaaa
gcaatcatcgatgcaattaaataa

DBGET integrated database retrieval system