KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_1481Help
Entry
ERH_1481          CDS       T01525                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ERH_1481 (rbsK)
Enzymes [BR:erh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ERH_1481 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1566142..1567044)
Genome map
AA seq 300 aa AA seqDB search
MKVLNFGSMNIDNVYYLDRFVQPGETKDVRKLEVNPGGKGLNQSIAMRRAGIDVCHAGIL
GKGGNVLKEYLDENEVDVHLVKMDDILQGHAIIQVDEIGENCIIVYSGSNGSVDREYIDN
VLTQFDHETMLVLQNEISELEYVVNEAHKRGMTIVLNPSPLTESLKQIDLNKISWLIMNQ
VEAEMMSGCTETEAILDTFKVKYPDLNCVLTLGSKGSVCLYEGSIIEQVAFQTKAVDTTG
AGDTFAGYFVAGMSRNKPIQEVLNDASKAAALCVSRYGAAPSIPYYKDLAQLTSFKGEKR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtccttaattttggttcaatgaatattgacaatgtttactatcttgaccggttt
gtacaacctggagaaaccaaggatgtcagaaaattggaagtaaatcctggtggaaaaggg
ttaaatcagtctattgcaatgaggcgtgcgggcattgatgtctgccatgctggaatttta
ggaaagggagggaatgtacttaaagaatatttagatgagaacgaagttgatgtacatttg
gtcaagatggatgatatcttgcaagggcatgcaatcatacaggttgatgaaattggtgaa
aactgcattatcgtttacagcggttcaaacggaagcgtggatcgtgagtatattgataat
gtcttaactcagtttgatcacgaaaccatgcttgttttacaaaatgaaatcagtgagttg
gagtacgtggtcaatgaagcacacaaacgtggaatgaccattgttcttaatccgtccccc
cttactgaaagtctaaagcaaatagatttaaataagatcagttggttgattatgaaccaa
gttgaggcagaaatgatgagtggttgcacggaaacggaggccattctggatacatttaaa
gtgaagtacccagatttaaattgtgtactaacgcttgggagcaaaggaagcgtgtgtctc
tatgaaggaagcatcatcgagcaggttgcttttcaaaccaaggctgtcgatacaaccgga
gctggggatacgtttgcaggatattttgtagcgggtatgagtcgcaacaaaccaatccaa
gaggtattaaacgatgcatcaaaggccgcagcattgtgtgttagtcgttatggagcggca
ccatcaataccctattataaagatttagctcagttaacatcattcaaaggagaaaaacga
tga

DBGET integrated database retrieval system