KEGG   Erwinia sp. Ejp617: EJP617_03060Help
Entry
EJP617_03060      CDS       T01935                                 

Gene name
aceF
Definition
(GenBank) Probable pyruvate dehydrogenase multienzyme complex, dihydrolipoamide acetyltransferase component(E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00010  Glycolysis / Gluconeogenesis
erj00020  Citrate cycle (TCA cycle)
erj00620  Pyruvate metabolism
erj01100  Metabolic pathways
erj01110  Biosynthesis of secondary metabolites
erj01120  Microbial metabolism in diverse environments
erj01130  Biosynthesis of antibiotics
erj01200  Carbon metabolism
Module
erj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EJP617_03060 (aceF)
   00020 Citrate cycle (TCA cycle)
    EJP617_03060 (aceF)
   00620 Pyruvate metabolism
    EJP617_03060 (aceF)
Enzymes [BR:erj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EJP617_03060 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA DUF1223 DUF4813 DUF3597
Motif
Other DBs
NCBI-ProteinID: ADP09987
UniProt: E3DDI2
Position
complement(330559..332157)
Genome map
AA seq 532 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVKVGDTVEVEQSILVVEGDKASMEVPSPQAGVVKEIKIA
TGDRVETGKLIMIFEAAGDAPAPAVAEEKQEAAPAAAAAAPAAASAAKEVNVPDIGGDEV
EVTEIMVKVGDKVEAEQSILTVEGDKASMEVPAPFAGTVKEIKISAGDKVSTGSLVMVFD
VEGAAPAAAPAAKAEAAAPAAAKQEEKAAPAAAPAKAEAKSEFAENDAYVHATPVIRRLA
REFGVNLAKVKGTGRKSRILKEDVQSYVKDAVKRAEAPAAAGGGMPGMLPWPRVDYSKFG
EVEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFT
PVVFIMKAVAAALEQMPRFNSSLSEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKG
IVELSRELTAISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKS
AMEPVWNGKEFMPRLMMPISLSFDHRVIDGADGARFITIINNTLADIRRLVM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaatgttcctgatatcggggcggatgaagttgaagtcaccgagatc
ctggtcaaggttggcgacacggtagaagttgagcagtcgatactggtagttgaaggcgac
aaagcctcaatggaagtgccttcgccgcaggctggcgtggtgaaagagatcaaaatcgcc
accggcgaccgggttgaaaccggtaaactgattatgatcttcgaagcggctggcgatgcg
cctgcaccggcagtggctgaagagaagcaagaggcggctccggccgctgctgctgcggcc
ccggcggctgccagcgcggcaaaagaagtgaacgtaccggatatcggcggcgacgaagtt
gaagtgaccgagatcatggtcaaagtcggcgacaaggttgaagcggaacagtcgatcctt
accgttgagggcgacaaagcctcaatggaagtgcctgcaccattcgccggtacggttaaa
gagatcaaaatcagcgctggcgataaagtcagcaccggttctctggtaatggtctttgac
gttgagggcgcagcgcctgctgcggctccggcggcgaaagctgaagcggccgcgcctgct
gctgcgaaacaggaagaaaaagccgctccggcagcggctcctgctaaagcggaagcaaag
tctgaatttgcagaaaacgatgcctacgtgcacgccacgccggttatccgccgtctggcg
cgtgaattcggcgttaacctggcgaaggtcaaaggcaccggacgcaaatcacgaattctg
aaagaagacgtgcagagctacgtgaaagacgcggtgaaacgtgccgaagcgccagcggct
gccggtggcggaatgccgggcatgctgccgtggccgagagtcgactacagcaagtttggt
gaagttgaagaagtcgagctgggccgcatccagaaaatttctggtgctaacctgagccgt
aactgggtgatgatcccgcacgttacccacttcgacaaaaccgatatcaccgatctggaa
gcgttccgcaaacagcagaacgccgaagcagagaagcgcaagctggacgtgaagttcacc
ccggtggtgttcatcatgaaagccgttgccgctgcgctggagcagatgccgcgctttaac
agctcgctgtctgaagatgcgcagaagctgacgctgaaaaaatacatcaacatcggcgtg
gcggttgatacgcctaatggcctggtggttccggtcttcaaggacgtcaacaaaaaaggc
attgttgagctgtcgcgtgaactgaccgccatctctaaaaaagcgcgtgatggtaagctg
actgccggagaaatgcagggcggttgcttcaccatctccagcattggcggcctggggacg
acccactttgcgccaatcgttaacgcgccggaagtggctatccttggcgtctccaagtcg
gcgatggagccggtgtggaatggtaaagagtttatgccgcgtctgatgatgccgatttcg
ctctccttcgaccaccgcgtgatcgacggtgcggacggtgcgcgctttattaccatcatt
aataacaccctggccgacatccgccgtctggtgatgtaa

DBGET integrated database retrieval system