KEGG   Erwinia sp. Ejp617: EJP617_04070Help
Entry
EJP617_04070      CDS       T01935                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00260  Glycine, serine and threonine metabolism
erj00750  Vitamin B6 metabolism
erj01100  Metabolic pathways
erj01110  Biosynthesis of secondary metabolites
erj01120  Microbial metabolism in diverse environments
erj01230  Biosynthesis of amino acids
Module
erj_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EJP617_04070 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EJP617_04070 (thrC)
Enzymes [BR:erj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EJP617_04070 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADP10088
UniProt: E3DE85
Position
complement(448659..449945)
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGKQQGLFFPLELPEFELTEIDDMLDMDFVTRSSKILS
AFIGDEIPPHQLNERLKTAFTFPAPVVEVTDNIAALELFHGPTLAFKDFGGRFMAQMLSY
VSDADEQITILTATSGDTGAAVAHAFYGMENVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDVCQSLVKQAFDDEELKKTIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLANGEWTPNATVATLSN
AMDVSQPNNWPRVEELFRRKTWRLTDLGYGAVDDETTKAAMRELADLGYLSEPHAAIAWR
LLHEGLQEGEFGLFLGTAHPAKFKESVEEILQRTLPLPDALAERADLPLLSHRMKAEFAD
LRAFLLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatcttaaggatcacaacgagcaggtgagcttcgcccaggcggtgaag
caggggctgggcaaacagcagggcctgttctttcctctggagttacctgagtttgaactg
actgaaattgatgacatgctggacatggatttcgtgacccgtagcagtaaaattctttcg
gcgtttatcggtgatgaaattcccccgcaccagctgaatgagcgtttgaaaacggcgttt
accttcccggcaccggtggtggaagtcactgataatatcgctgcgctggagctgttccac
ggcccgacgctggcgtttaaagactttggcggccgctttatggcgcagatgctctcttat
gtcagcgatgcggacgagcagatcactattctgaccgcgacttccggcgataccggagcc
gccgttgctcatgctttctacggtatggaaaacgtgcgcgtggtgatcctttatccacag
ggcaagatcagcccgctacaggaaaaactgttctgtaccctcggtggcaatatcgagacc
atcgccattgacggcgatttcgatgtttgccagtcgctggttaaacaggcgtttgacgat
gaagagctgaaaaagaccattggcctcaactcggcgaactcgattaatatcagccgcctg
ctggcgcagatctgctactactttgaagccgtggcgcagctgccgcaggaaaaacgtaat
cagctggtgatttcggtgcccagcggtaactttggcgacctgacggctggcctactggcg
aagtctcttggtctgccggtgaagcgttttattgctgccaccaacgccaatgacaccgtg
ccgcgcttcctggccaacggcgagtggacgcccaacgccaccgtggccacgctgtcaaac
gcaatggacgtcagccagccgaacaactggccgcgcgttgaagagctgttccggcgtaaa
acctggcgcttaacggatctcggctatggtgcggtcgacgatgagaccaccaaagcggcc
atgcgtgagctggccgatctcggttacctttccgagccacatgcggctatcgcctggcgc
ctgctgcatgagggattacaggaaggggagtttggtctgttcctcggcaccgcgcacccg
gcgaaatttaaagagagcgtggaagagatcctgcaacgcacgttgccgctgccggatgca
ctggccgagcgcgccgatctgccgttgctgtctcaccgcatgaaagcggaatttgccgac
ctgcgtgcgttcctgctgaagaagtaa

DBGET integrated database retrieval system