KEGG   Erwinia sp. Ejp617: EJP617_04340Help
Entry
EJP617_04340      CDS       T01935                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
erj  Erwinia sp. Ejp617
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EJP617_04340 (deoA)
Enzymes [BR:erj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     EJP617_04340 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(478697..480148)
Genome map
AA seq 483 aa AA seqDB search
MVAIAHLHRGGVTPYAAMCVSRPAMAITPVWTRIIDGIVLGVIVFLPQEIIRKKRDGHAL
SEEEIRLFINGVCDNSVSEGQIAALAMAIWFRDMTLPERVALTMAMRDSGSVLSWKALDL
NGPVVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFP
QDDRFRQIIKQVGVAIVGQTRSLAPADKRFYATRDITATVDSIPLIAASILAKKLAEGLD
ALVMDVKVGSGALMPALEQSEALAQAIFGVANGAGCHTTVLLTDMNQALASRAGNALEVR
EAVQFLTGEYRNPRLLEVTMALCSEMLLSGGLAQSGDEAQIKLQAVLDNGAAAEVFARMV
AAQKGPTDFIERIDSYLPVPMLSKAVYANTSGIVSAMDTRALGMAVVALGGGRRRASDSI
DYSVGFSDLVQLGDKVGSQRPLAVIHAASEAGWQQAARALQHAVVVGQVAPASTPVIYRR
ISQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ttggttgccattgcgcacctgcaccgtggcggggtaacaccgtacgcggcgatgtgcgtc
tccagaccggcgatggccatcacgccagtatggacccgcatcattgatggcattgtcctg
ggagtcatcgtgtttctgccacaagaaattatccgcaaaaaacgtgatggtcatgcactg
agcgaagaagagatccgtctgtttattaacggcgtgtgtgacaactcggtttcagagggg
cagattgccgcgctggcgatggccatctggtttcgtgatatgacgctgccggagcgtgtg
gcgctgacgatggcgatgcgcgattccggttcggtactcagctggaaagcgctggatctc
aacggcccggtggtggacaaacactcaaccggcggcgtgggcgatgtcacgtcgctgatg
cttggcccaatggtggctgcctgtggcggctatgtgccgatgatctccggccgtgggctt
ggtcataccggcggcacgctggataaactggaagccattcccggttttgatattttcccg
caggacgaccggttccgccagattatcaaacaggtaggggtggctatcgtcggccagacc
cggtcgctggctccggcggataagcgcttctatgccacgcgtgatattaccgccacggta
gattcaatcccgcttattgctgcctcgatcctcgccaagaaactggctgaaggtcttgat
gcgctggtcatggacgtgaaagtgggttccggggcgctgatgcctgctcttgaacaatcc
gaagcgctggcgcaggccatttttggcgtagcaaacggtgccggttgtcacaccaccgtg
ctgttaaccgatatgaaccaggcgctggcttcccgcgccggtaatgcgctggaagtgcgt
gaagcggtgcagttcctgaccggcgaataccgcaatccgcgcctgctggaagtgacgatg
gcgctgtgcagcgaaatgttgctctccggcgggctggcgcagtcaggcgatgaagcgcag
attaagctgcaggcggtgctggacaacggtgccgccgccgaggtgtttgcgcgcatggta
gcggcgcagaaggggccgactgactttatcgagcgtatcgacagttatctgcctgtcccg
atgctgagcaaagcggtttatgccaacaccagcggcatcgtcagcgcgatggacacccgt
gcgctggggatggcggtagtggcgctgggcggcggtcgccgccgggccagcgacagcatt
gactacagcgttggcttcagcgacctggtgcagctgggcgataaggtgggtagccagcgt
ccgctggcggtgatccatgccgccagcgaagccggctggcagcaggccgcccgggccttg
cagcacgccgtcgttgtcgggcaggtggcgccggcatcaacgccagttatttatcgcaga
atctcgcaataa

DBGET integrated database retrieval system