KEGG   Erwinia sp. Ejp617: EJP617_04890Help
Entry
EJP617_04890      CDS       T01935                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
erj  Erwinia sp. Ejp617
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:erj00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:erj00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:erj03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:erj03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:erj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(537975..538439)
Genome map
AA seq 154 aa AA seqDB search
MLAKSGPPAIGQEKMMSPRRDWFLQQMGITQYTLRRPRALQGEIAITLPAETRLVIVADN
PPMLHDPLVADVLRALNLHQPQVQVLTPDQLAMLPDDACCPSWRLGLEAPVTLAGTQIAS
PVLAELYHNAEAKRSLWQQICQHESDFFTHSARP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgaaaagcggccccccggcaatcggacaggaaaaaatgatgtctcccagacgt
gactggttcttacagcaaatggggattacgcagtatacgctgcggcgtccgcgcgccttg
cagggcgagatcgcgataacgttacccgctgaaacccgcctggtgatcgtggcggataat
ccgcccatgctgcacgacccgctggtggcggacgttttacgcgccctgaatctgcatcaa
ccgcaggtgcaggtacttaccccagaccagctggcgatgctgccggatgatgcctgctgt
cccagttggcgtttagggctggaagccccggtgacattagccggaacccaaattgcttcg
cccgtactggcggagctttatcacaatgccgaggccaaacggtcgctctggcagcaaatt
tgccaacatgaatcagatttctttactcactctgcacgaccttga

DBGET integrated database retrieval system