KEGG   Erwinia sp. Ejp617: EJP617_05040Help
Entry
EJP617_05040      CDS       T01935                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
erj  Erwinia sp. Ejp617
Brite
Enzymes [BR:erj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EJP617_05040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(554949..555458)
Genome map
AA seq 169 aa AA seqDB search
MNHSIVKHCAVGAVLAAVAMLPKYQQLHTSPDGLKLLADYEGCRLMPYQCSAGIWTDGIG
NTEGVVPGRSITGQQAAGNLITNVLRVESALAQCVTEPVPQSVYDSLVSLAFNVGTTKTC
GSTMVKLLNEKRWRDACQQLPRWIYVKGVFNPGLKKRRAREMAWCLTGI
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattcaatcgttaaacattgtgctgtcggcgcggtactggctgctgtcgccatg
ctgccgaaatatcagcagctgcatacctcaccagatgggctgaaactgttggcggactat
gaaggctgtcgtctgatgccttatcagtgcagcgccgggatatggacggacggcatcggc
aacaccgaaggcgtggtaccgggccgcagcattaccgggcagcaggcagcagggaattta
atcaccaatgtactgcgcgttgaatcagcactggcgcagtgtgtgacggaacccgtgccg
cagtcagtgtatgactcgctggtctctctggcctttaacgtcggtaccactaaaacctgt
ggttcgacgatggtgaagctgctaaacgaaaagcgctggcgtgacgcctgccagcagctg
ccgcgctggatctatgttaaaggcgtgttcaacccggggcttaaaaagcgccgcgcaagg
gagatggcctggtgcctgaccggaatatga

DBGET integrated database retrieval system