KEGG   Erwinia sp. Ejp617: EJP617_05820Help
Entry
EJP617_05820      CDS       T01935                                 

Gene name
cysQ
Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
erj  Erwinia sp. Ejp617
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    EJP617_05820 (cysQ)
Enzymes [BR:erj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     EJP617_05820 (cysQ)
Transfer RNA biogenesis [BR:erj03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    EJP617_05820 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(641760..642500)
Genome map
AA seq 246 aa AA seqDB search
MLEKICQLAREAGDAIMQVYDGQAPLDVAQKPDDSPVTAADMAAHKVIVAGLQALTPTIP
VLSEEAPQSWEIRQHWQQYWLVDPLDGTKEFIKRNGEFTVNIALIKAGKAVLGVVYAPVL
AVMYYAAEGKAWKEEGGHKIRIQVQDARPPLVVVSRSHADSELEDYLKQLGDHQTTAIGS
SLKFCLVAEGKAQLYPRFGPTNIWDTGAGHAVAAAAGAHVNDWQGKPLDYAPRESFLNPG
FRVSIF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaaaaaatttgccagctggcgcgtgaagcaggtgatgccattatgcaggtgtat
gatggacaggctccgctggatgtggcgcagaagcccgatgactcaccggtgactgccgca
gacatggcggcgcacaaggtgattgtcgccggactacaggcgttaacccccaccatcccg
gttttgtctgaagaagcgccgcagagctgggagatacgccagcactggcagcaatactgg
ctggtggatccgctcgacggcaccaaagagtttatcaaacgtaacggggagtttacggtc
aatatcgcgctgattaaagcgggaaaagcggtactgggagtggtctatgcgccggtactg
gcggtgatgtattacgctgccgaaggcaaagcctggaaggaagagggtggccataaaatc
aggattcaggtgcaggatgcgcgcccgccgctggtggtagtcagtcgttcacatgccgac
agcgaactggaagattacctcaagcaactcggcgaccatcagaccaccgcgattggctcc
tcgctgaagttctgcctggtggcagaggggaaagctcagctctatccgcgcttcgggcct
accaatatctgggataccggtgcaggccacgcggtggctgcggctgcgggcgcgcacgtc
aatgactggcagggaaaaccccttgattatgccccgcgcgaatcattcctcaatccgggg
ttccgcgtatccattttttga

DBGET integrated database retrieval system