KEGG   Erwinia sp. Ejp617: EJP617_09270Help
Entry
EJP617_09270      CDS       T01935                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
erj  Erwinia sp. Ejp617
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EJP617_09270
Enzymes [BR:erj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     EJP617_09270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997344..999032
Genome map
AA seq 562 aa AA seqDB search
MTNINQLIDEIYDSAFPPARLQQLHALIAAARERHHQPRKMHWDEQDVVLITYADQFRED
NTPTLTTFSRFYRQHLQSSFNLVHLLPFFPSSSDDGFAVIDYHQVNPPFGGWQEIADLHQ
HTRLMFDFVCNHMSAHSDWFARYLAQDPGWDNFFISWSPAADLSAVTRPRTSPLLTPFVM
ANGETRSIWTTFSADQVDLNYANPDVLLSMVTVLLDYLQQGADYLRLDAVGYLWKTPGTA
CIHLAKTHLLVKLFRAIIDEVAAGTVLLTETNVPHHDNIGYFGNGHDEAQMVYQFPLPPL
VLHAIHHGSSRALRQWASSLDGDSGSTTFFNFLASHDGIGLNPLRGILPEREIVALAQDL
AREGAPISWKTNPDGTTSPYEINVTWLDALSKKQDDDDSRLQRFLLAHGLLLAFPGVPAV
YVQSILGSRNDMDGVKVSGMNRAINRQKYALSDIEKALATTGSLRQRIYTALSQLIQVRI
GQPAFHPDNPMTISDSDDSLLVMQRQTKNAQDTLWCVFNLGGKPVGYSLPEPRWYRDVAS
GERIDGKEVLVLGAWQFRWLKA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgactaatatcaaccagttgatagatgagatttatgattccgctttcccgccagcacgc
ctgcaacagctgcacgcgctgattgccgctgcccgcgagcgtcatcatcagccgcgcaaa
atgcactgggacgagcaagacgtggtgttaatcacctacgcggatcagtttcgtgaagat
aacacccccaccctgacaaccttctcacgcttctaccggcaacatttacagtccagcttt
aacctcgttcacctgctgccctttttcccttcatcgtcagacgatggctttgcggtgatt
gactatcaccaggtgaatccacctttcggcggctggcaggaaattgccgacctgcatcag
cacacgcgcctgatgtttgacttcgtctgcaaccatatgtcggcccacagcgactggttc
gcccggtacctggctcaggatcccggctgggataacttttttatcagctggtcacccgct
gctgatttaagcgcggtcacccgaccgcgcacttcgccgttgctcacgccgttcgtgatg
gcaaacggcgagacgcgctcaatctggaccacattcagcgccgaccaggtcgaccttaat
tatgccaatcccgacgtgctgctcagtatggtcaccgtgctgctggattatttacaacag
ggggcagattacctgcggctggatgcggtgggttacttatggaaaaccccgggtacggca
tgcatccatttagcgaaaacccacctgctggtgaagctgttccgcgccatcatcgacgag
gtggcagcgggaacggtgctactgaccgaaaccaacgtgccgcatcacgacaacatcggc
tatttcggcaacggccatgatgaagcgcaaatggtctatcagtttccgttgccgccgctg
gtgctgcatgccatccaccacggttcgtcacgcgcattacgccagtgggcatcctcgctc
gacggcgacagtggcagcaccaccttctttaatttcctcgcctcccatgacggtatcggc
ctgaatccgctgcgcggcattctgcctgaacgcgaaattgtcgcgctggcgcaagacctg
gcgcgggaaggcgcgccgatctcgtggaaaaccaatcctgatggcaccaccagcccttat
gaaatcaacgtcacctggctggacgcgctgagtaaaaaacaggacgacgacgatagccgc
ctgcaacgctttttgctggctcacgggctgctgctggcttttcccggcgtgccggcagtc
tacgtgcagagcattcttggctcgcgcaatgacatggacggcgtcaaagtctccgggatg
aaccgggcgatcaaccgccagaaatatgcgctgagtgacattgaaaaggcgctggccacg
acgggttcgttacgccagcggatctataccgcactcagtcaactgattcaggtgcgtatt
gggcagccggcatttcatccggataatcccatgacgattagcgacagcgatgattcgctg
ctggtgatgcaaaggcagacaaaaaatgcacaggatacgctgtggtgcgtgttcaacctg
ggcggtaagccggtcggctacagtctgcccgaaccgcgctggtatcgcgatgtcgccagc
ggtgaacggattgatggtaaagaggtgctggtgctgggcgcatggcaatttcgctggcta
aaagcctga

DBGET integrated database retrieval system