KEGG   Erwinia sp. Ejp617: EJP617_09310Help
Entry
EJP617_09310      CDS       T01935                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
erj  Erwinia sp. Ejp617
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EJP617_09310 (malQ)
Enzymes [BR:erj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EJP617_09310 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1001391..1003460)
Genome map
AA seq 689 aa AA seqDB search
MSVKKCEQAAAKAGIATSWINAAGQEQAVSQTTGEKLLAAMNKPQKASNAPLPPCKVLLK
KRVQQLEIAGKGNYQWQLCGEHGKTFQGSVSAGELLTLPANLPNGYHQLLLSQGKKQWAC
RVIIAPKRCYEPAALKQGGKLWGAMVQLYTLRSQHNWGAGDFGDLKRMVSEIAVRGGSFI
GLNPIHALYPGIPENASPYSPSSRRWLNVMYIDVAAVTDFQQSQAAQRWWRQKNTRQRLE
KARQAEWVDYATVAELKIRGLRYAWQQFSQRTLQDPSHTDFERFIVDGGQSLSDQAAYDA
LHAQMLQQDPERWGWPAWPEAYQHGRSDAVQQFRCERAGEVRFWQWLQWLADRQFAECWQ
CCRQHHMAIGLYRDLAVGVAQGGAETWCDRELYRLQASVGAPPDILGPQGQNWGLPPMDP
HVLTARGYQPFIDMLRANMVNCGALRIDHVMSLLRLWWIPYGETANFGAYVHYPVDDLMA
ILALESERQQCMVIGEDLGTVPPEIVSKLRASGIYSWKVLYFEQDESGRYRSPDAWPRQS
MASATTHDLPTLRGFWNEGDLILGETLGLYPDKQVLSELFADRARKKQALLDALHRSGCV
AKRSGKRAAKMAMSSVLNRGMQRFIADSNSALLGLQPEDWLDMEKPVNVPGTTDQYPNWR
RKLSVTQEEMFTDARINRLLKDLNKRRSG
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgaaaaagtgtgaacaggccgctgcaaaggccggtattgccaccagctggatc
aatgccgccggtcaggagcaggccgtcagccagacgacgggtgaaaagctgctggcggca
atgaataagccgcaaaaagccagcaatgccccgctgcccccctgtaaggtgctgctgaaa
aaacgggttcagcagctagagattgccggcaaaggcaactatcaatggcagctgtgcggc
gagcacggcaagacgtttcagggtagcgtatccgctggtgagctgctgacgctgccggcg
aatttgcccaacggctatcatcagctgctgcttagccaggggaagaagcagtgggcgtgc
cgggtgattattgcaccgaaacgctgttatgaaccggcagcgctcaaacagggcggcaaa
ttgtggggcgcgatggtgcagctttacacccttcgctcgcagcacaactggggggcaggc
gacttcggcgatctgaaacgcatggtcagtgagattgccgtacgtggcggctcctttatc
ggcctgaaccccatccacgctctgtaccccggcatcccggaaaacgccagcccttacagc
ccttcatcgcgccgctggctcaacgtgatgtatatcgacgtggcggcggttaccgacttc
cagcaaagccaggccgcgcagcgctggtggcggcaaaagaatacccggcagcggctggag
aaggcgcgccaggcagaatgggtggattacgccacggtggctgaactcaaaattcgcggg
ctgcgctacgcctggcagcagttctcgcagcgtacgctgcaggatcccagccacactgac
ttcgagcggtttattgtcgacggcgggcaaagtctgtctgaccaggctgcctatgacgcc
cttcacgcgcagatgctgcaacaagacccggagcgctggggctggccggcctggccggaa
gcttatcagcacgggcgcagcgacgcggtgcagcagttccgttgtgaacgggctggtgaa
gtgcgtttttggcagtggctgcagtggctggccgaccgtcagttcgccgaatgctggcag
tgctgccggcagcatcatatggcgattggcctgtaccgcgacctggcagttggcgtggcg
caaggcggtgcagaaacctggtgtgaccgcgaactgtatcgcctgcaggcatcggtaggc
gcgccgccggatatccttggcccgcaggggcagaactgggggctgccgccgatggatccg
catgtgctgaccgcgcggggttatcagccctttatcgatatgctgcgcgcaaatatggtc
aactgcggcgcattgcgtatcgatcatgtgatgtcgctgctgcgcctgtggtggatccct
tacggtgaaaccgccaactttggtgcctatgttcactacccggtggacgatctgatggcg
atcctcgccctggaaagcgagcgccaacagtgcatggtgataggtgaagatctcggcacg
gttccgccggagatcgtcagcaaactgcgtgccagcggcatctattcctggaaagtcctc
tatttcgagcaggatgagtcggggcgttaccgttctcctgatgcctggccacgtcagtca
atggccagcgccaccacccacgatctgccgacgctacgcggtttctggaacgaaggggac
ttaatccttggcgaaacgctggggctgtacccggataagcaggtactcagcgaactcttt
gccgaccgggcgcgcaaaaaacaggcgctgctggatgccctgcaccgcagcggctgtgta
gcgaaacgcagcggtaaacgggcggccaaaatggcaatgtcgtcggtactgaatcgtggt
atgcagcgttttattgccgatagcaacagtgcgctgctgggcttgcagcccgaggactgg
ctggatatggaaaagccggtcaacgtaccgggcaccactgaccagtacccgaactggcga
cgcaagctaagcgtgacgcaggaggagatgtttactgacgccagaataaaccgcctgctc
aaagaccttaataaacgccgcagcggctga

DBGET integrated database retrieval system