KEGG   Erwinia sp. Ejp617: EJP617_11920Help
Entry
EJP617_11920      CDS       T01935                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
erj  Erwinia sp. Ejp617
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EJP617_11920 (rbsK)
Enzymes [BR:erj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EJP617_11920 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1309817..1310746
Genome map
AA seq 309 aa AA seqDB search
MKKTGRLAVLGSINADHILNLAHFPRPGETVIGKQYQVAFGGKGANQAVAAARSGADMAF
IACVGEDDIGGRIRQQLANDRIDVASVAVISGGATGVALIFVNGEGENTIGIYAGANAAL
TPERVLEHQQTIAQAQVLLMQLESPLDSVLAAARIAQHHHTRVVLNPAPATQLSDELLAL
VDIITPNETEAQILTGIAVNSDEDAARAAQKLHEKGIATVLITLGSRGVWLSEQGNGHCV
PAFSVAAVDTIAAGDTFNGALMTALLEQRPMVEAVRFAHAAAAIAVTRHSAQPSVPWRDE
IDSFLQQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccggcaggctggccgtcctcggcagcatcaacgccgatcacattctgaat
ctggcgcactttccgcgtccgggcgaaacggtgatcgggaagcagtatcaggtcgcattc
ggtggaaaaggcgctaaccaggccgttgccgccgcacgcagcggcgcggatatggcgttt
atcgcctgcgtgggcgaagacgatatcggcgggcgtattcgccagcagttggctaacgat
cgcattgatgtcgcttctgtcgcggttatcagcgggggggctaccggcgtggcgctgatt
tttgtcaacggtgagggtgaaaataccatcggtatttatgccggtgccaatgccgctcta
acgccggagcgcgtgcttgagcatcagcagacgattgcgcaagcacaggttttactgatg
cagctggagtcgccgctggatagcgtgctggcagcagcgcgtattgcacagcaccaccac
acgcgggtggtgttgaatccggccccggcgacgcaactttcggatgagctgctggcgctg
gtcgatatcatcacccccaatgaaaccgaagcgcagatcctgaccggcatagcggtaaac
agtgacgaagacgcagcccgtgccgcacaaaagctgcatgagaaaggcattgcaacggtg
ctgattacgcttggcagccggggtgtatggctcagtgagcagggtaacggtcactgtgtt
cccgcgtttagcgtggcagccgtcgatactatcgctgccggggatacctttaacggcgcg
ttgatgaccgcattactggagcagcgtccaatggttgaggcggtacgttttgcccatgcc
gctgcggcgattgccgtgacgcgccatagcgcgcagccttccgttccgtggcgtgacgaa
atagacagcttcttgcagcagcaggggtag

DBGET integrated database retrieval system