KEGG   Erwinia sp. Ejp617: EJP617_12410Help
Entry
EJP617_12410      CDS       T01935                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
erj  Erwinia sp. Ejp617
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:erj03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1369874..1370683
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNARLRWPVSQEIHALSDQPVLSVQRRAKYLL
LELPTGWIIIHLGMSGSLRVLPEDLPAAKHDHVDLVMSNGKVLRYTDPRRFGAWLWCADL
NGSSVLSHLGPEPLSDSFSARYLFEKSRGKRTAIKPWLMDNKVVVGVGNIYASESLFVAG
ILPDRPAMALSEQEAGLLVSTIKAVLLRSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRT
GEPCRVCAMPVESSKHAQRSTFFCRRCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttaccagaggtagaaaccagccgacgcggaattgaaccgcatcttgtggga
gccaccattctgcacgcggtggtgcgtaacgctcgtctgcgctggccggtttctcaggaa
atccatgcgctaagcgaccagcccgtgctcagcgtccagcgccgggcaaagtacctgttg
ctggagcttcccaccggatggattatcattcatctggggatgtcgggcagcctgcgtgtt
ctgccagaggatttgccggcggcaaaacatgatcatgtcgacctggtaatgagtaacggc
aaagtgctgcgctacaccgatccgcgccgttttggtgcctggctgtggtgcgccgacctg
aatggcagttcggtgttatctcatctggggcctgagccgctgagcgatagtttttccgca
cggtatctgtttgaaaaatccaggggtaaacgcacggctattaaaccctggctaatggat
aataaagtcgtggtgggcgtgggtaatatctatgccagcgaatcgctatttgtggctggg
atcctgcccgatcgtccggcgatggcgcttagcgagcaggaagccggactattggtcagc
accattaaagccgtattgttacgttcgattgagcagggcgggaccacattgcgcgacttt
ttacaaagtgacggcaagccgggttatttcgctcaggagctgcaggtatatggccggaca
ggggagccttgccgcgtctgcgctatgccggtagagagcagtaagcatgcgcagcgtagc
acttttttctgccgccgctgccagaaatag

DBGET integrated database retrieval system