KEGG   Erwinia sp. Ejp617: EJP617_12690Help
Entry
EJP617_12690      CDS       T01935                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
erj  Erwinia sp. Ejp617
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EJP617_12690 (pfkA)
   01230 Biosynthesis of amino acids
    EJP617_12690 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EJP617_12690 (pfkA)
   00030 Pentose phosphate pathway
    EJP617_12690 (pfkA)
   00051 Fructose and mannose metabolism
    EJP617_12690 (pfkA)
   00052 Galactose metabolism
    EJP617_12690 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EJP617_12690 (pfkA)
Enzymes [BR:erj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EJP617_12690 (pfkA)
Protein phosphatases and associated proteins [BR:erj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EJP617_12690 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1397024..1397986
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVCGIYDGYLGLYEDRMINLDRYSVSD
MINRGGTFLGSARFPEFRHEDVRSVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIPYTREELVNEIKAGIAKGKKHAIVAITEHICDIDELAKYIEQETK
RETRSTVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaatcggtgtactgaccagtggtggcgatgccccaggcatgaatgcggcg
atccgtggtgttgtgcgcgccgcccttagcgaaggtcttgaagtttgcggcatttatgac
ggctatctgggcttgtatgaggaccgcatgatcaatctcgaccgctacagcgtatcggat
atgattaaccgtggcggtaccttcctgggttccgcacgcttcccggagtttcgccatgag
gatgtgcgcagcgtcgccatcgaaaacatgaagaaacgcggcatagacgcactggtggtg
atcggcggtgatggttcgtatatgggggccaagcgcctgaccgaaatgggcttcccatgt
attggtctgccgggcaccattgataacgacgtggccggcacggattacaccattggctat
ttcaccgcgctggaaaccgtggtggaggcgatcgaccgcttgcgtgatacttcgtcctcg
caccagcgtatttcaatcgttgaggtgatggggcgttactgtggcgatctgacgctggca
gcggcgattgccggtggctgtgagtttatcgtactgccggaaattccttatactcgtgag
gagctggtgaatgagatcaaagccgggattgccaaaggtaaaaagcacgcgattgtagcg
atcacggaacatatctgcgatatcgacgagctggcgaaatatatcgaacaggaaaccaaa
cgcgaaacgcgctcaacggtgctgggtcatattcagcgcggcggtgctccggttgcttat
gaccgtattctcgcgtcacgcatgggtgcctactcgatagaactgctgttacaaggttac
ggtgggcgctgtgtcggcattcagaatgagaagatggtgcatcacgatattatcgatgcg
attgaaaacatgaaacgtccgtttaaaggtgactggctggataccgccaagaaactctac
tag

DBGET integrated database retrieval system