KEGG   Erwinia sp. Ejp617: EJP617_12960Help
Entry
EJP617_12960      CDS       T01935                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
erj  Erwinia sp. Ejp617
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EJP617_12960 (glpK)
Enzymes [BR:erj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EJP617_12960 (glpK)
Exosome [BR:erj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EJP617_12960 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1423564..1425078)
Genome map
AA seq 504 aa AA seqDB search
MTAEKKYIVALDQGTTSSRAVILDHDANIVAVSQREFQQIYPKPGWVEHDPMDIWASQSS
TLVEVLAHADINSDEIAAIGITNQRETTIVWEKQTGKPIYNAIVWQDPRTADYCAKLKKE
GLEEYIRHTTGLVINPYFSGTKLKWILDHVEGSRERARRGELLFGTVDSWLVWKMTQGRV
HITDYTNASRTMMFNIHQLEWDRRMLEILDIPREMLPEVKSSSEVYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFMLMNTGTEAVTSTQGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDEMKLIGDAADSEYFATKVKDTNGVYMVPAFTGLGAPYWDP
YARGAIFGLTRGANANHIIRATLESIAYQTRDVLEAMQNDANTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPEVREVTALGSAYLAGLAVGFWKDLDEVRAKSVIEREFRPGIETTR
RNVLYAGWKKAVARAQAWEEADDR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgaaaagaaatatatcgtcgcgctcgaccagggaaccaccagttcccgcgcc
gtgatcctcgatcatgacgccaatattgtcgcggtgtcgcagcgcgaattccagcaaatc
taccctaagcctggctgggttgagcatgacccgatggatatctgggcttcgcaaagctcc
acgctggtggaagtgctggcgcatgcggatatcaattccgacgagattgccgctattggc
atcaccaatcagcgtgagaccaccattgtctgggaaaaacagaccggcaaaccgatctat
aacgctattgtctggcaggatccgcgcacggctgattactgcgcaaagctaaaaaaagag
gggctggaagagtacattcgccacaccaccggattagtgattaacccctacttctccggc
accaaactaaaatggatcctcgaccatgttgaaggttcgcgcgaacgcgcccggcgtggc
gaactgctgtttggcaccgtcgacagctggctagtatggaagatgacgcaaggacgggtg
cacatcaccgactacactaacgcctcgcgtaccatgatgttcaacattcatcagctggaa
tgggatcggcgcatgctggaaattctcgatattccgcgtgaaatgctgccggaagtgaag
tcgtcctctgaagtttatggccagaccaacattggcggtaaaggcggcacgcgcatccct
attgcgggtattgccggcgatcagcaggcggcgctgtacggccagctgtgcgttcagccg
gggatggcgaaaaacacctacggcaccggctgctttatgctgatgaacaccggcaccgaa
gccgtcacctccacccaaggcctgctgaccaccatcgcctgtgggccgcgtggtgaagtc
aactacgcgctggaaggcgcggtgtttatcggcggcgcgtcgattcagtggctgcgtgac
gagatgaagctgatcggtgacgccgcagactccgaatatttcgccacgaaagtgaaagac
accaacggtgtttatatggtgcccgccttcaccggcctgggcgcaccgtactgggatccg
tatgcccgtggtgccatcttcggcctgacgcgtggtgccaacgctaaccatattatccgc
gccacgctggagtcgatcgcctaccaaactcgtgatgtactggaagcgatgcagaacgat
gccaacacccgcctgcaatcactgcgcgtggacggtggtgccgttgccaataacttcctg
atgcagttccagtccgatattctcggtacgcgcgttgagcgccctgaagtgcgtgaagtg
accgcattgggatcggcctatctggcaggcctggccgttggcttctggaaagacctggat
gaagtgcgtgccaagtcggtgatcgaacgcgaatttcgcccaggcatcgaaaccacccgg
cgtaacgtgctgtacgccggctggaaaaaagccgttgcccgcgctcaggcgtgggaagag
gccgacgacaggtaa

DBGET integrated database retrieval system