KEGG   Erwinia sp. Ejp617: EJP617_14110Help
Entry
EJP617_14110      CDS       T01935                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
erj  Erwinia sp. Ejp617
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EJP617_14110 (pldB)
Enzymes [BR:erj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     EJP617_14110 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566951..1567943
Genome map
AA seq 330 aa AA seqDB search
MELHQKSWLTREKAFAAFATGPLLDFWKQREEGEFAGVADVPIRYVRFISPQHDKVILLC
PGRIESYVKYPELAYDLFHSGYDIFIIDHRGQGRSGRLLKDSHRGHVVAFEDYVDDLETL
YLQQIVTRDYRHRYALAHSMGGAILALMLVRQPAAFAAVALASPMFGLFLPMPLWMARRI
LNWAEKRPTVRDDYALGTGKWRARPFAVNDLTHSRERYRRNVRFYADDPGIRVGGPTYHW
VREGVRAGQSVLRQAAQISTPLLLLQAADDKVVDNRAQDLFCQTMLAAGRPCEGGKPMII
EGARHEILFEKDRMRAVALEAVLAFFARHA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaacttcaccagaaaagctggttaacgcgtgaaaaagcctttgcggcttttgctacc
ggcccgttgctggatttctggaagcagcgcgaagagggcgagtttgccggggtggcagac
gtaccgatccgctacgtccgcttcatctcaccgcagcatgacaaggttatattattgtgt
ccggggcgcattgaaagctatgtcaaatatccggagctggcctacgacctgttccatagt
ggatatgacattttcattatcgatcatcgcgggcaggggagatcgggcaggctgctgaaa
gattcacatcgtgggcacgtcgtggcgttcgaagactacgttgacgatctggaaacgctg
tatttgcaacagatcgtcacgcgtgactatcgccatcgctacgcgctggcgcattcgatg
ggcggggcgatcctcgccctgatgctggtacgacagcctgcggcctttgctgcggtggcg
ctggcttcgccgatgtttggtctttttctaccgatgcctttatggatggcgcgccgcatt
ctcaactgggcggaaaagcgcccaacggtgcgcgatgattatgcgctgggaaccggcaag
tggcgtgcgcgcccgtttgcggtaaacgatctgacgcacagccgcgaacgctatcgccgc
aatgtgcgcttttatgccgacgatcccggcattcgcgttggtggcccgacctatcactgg
gtgcgcgaaggcgtgcgcgccgggcaaagcgttttgcgccaggctgcacaaatctccacc
ccgctgctgctgctacaggccgccgacgataaggtcgtcgacaaccgcgctcaggatctg
ttctgccagacgatgctggcggcgggtcggccctgtgagggtggcaagccgatgattatt
gagggtgcgcgtcatgagatcctgtttgagaaggatcggatgcgcgcagtggcgcttgaa
gccgtcctcgccttttttgcccgccatgcctga

DBGET integrated database retrieval system