KEGG   Erwinia sp. Ejp617: EJP617_15180Help
Entry
EJP617_15180      CDS       T01935                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
erj  Erwinia sp. Ejp617
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EJP617_15180 (folP)
Enzymes [BR:erj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     EJP617_15180 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1695689..1696525
Genome map
AA seq 278 aa AA seqDB search
MKLFARDAVLDLSHPHVMGILNVTPDSFSDGGKHNELIQALTHANEMINAGATIIDVGGE
STRPGAAEVSTEQELDRVIPVVEAIAQRFEVWISVDTSKPEVIREAACAGAHIINDIRSL
QAPGALAAAAQTGLPVCLMHMQGEPKTMQQSPQYQDVLHDVKTFFVENIARCEAAGIKKS
QLLLDPGFGFGKNLSHNYQLLAHLADLHHFGLPLLVGMSRKSMIGQLLNVGPSQRLTGSL
ACAVIAAMQGVHILRVHDVKETVEAMRVVEATQSAREK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttcgccagagatgccgtgctcgatctttctcatccccatgtgatgggaata
ttgaatgtcactcctgactctttttctgatggcggcaagcataacgagttaatccaggcg
ctgacccacgcaaatgagatgattaacgccggagcaacgattatcgatgttggcggtgag
tctacccgtcctggtgccgcagaggtcagcacggagcaggagctggatcgcgttatcccg
gtggtagaagctattgctcaacgttttgaagtctggatctcggtcgatacttccaagcca
gaggtgatccgcgaagcggcctgcgccggggcgcatatcatcaacgatatccgctcactg
caagcacctggcgcgctggctgctgctgcgcaaaccggtttgccagtctgcctgatgcat
atgcagggcgaaccaaaaaccatgcagcagtcgccccagtatcaggacgttctgcacgat
gtgaagactttttttgtcgagaatatcgcccgctgcgaagcggccgggatcaaaaaatcg
cagttgctgctcgacccgggttttggtttcggtaagaatctctcccacaattatcaactg
ctggcgcatttggccgatttgcatcattttggcctgccgctgctagtcggcatgtcgcgt
aaaagtatgattggccagctactgaacgtcgggccatcgcaacgattgaccggcagcctc
gcctgcgcggtgattgccgcgatgcagggcgtccatattctgcgcgtgcatgacgtcaaa
gaaaccgtagaggcgatgcgcgttgtcgaagccacacagtccgcaagggaaaaataa

DBGET integrated database retrieval system