KEGG   Erwinia sp. Ejp617: EJP617_15180Help
Entry
EJP617_15180      CDS       T01935                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
erj  Erwinia sp. Ejp617
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:erj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1695689..1696525
Genome map
AA seq 278 aa AA seqDB search
MKLFARDAVLDLSHPHVMGILNVTPDSFSDGGKHNELIQALTHANEMINAGATIIDVGGE
STRPGAAEVSTEQELDRVIPVVEAIAQRFEVWISVDTSKPEVIREAACAGAHIINDIRSL
QAPGALAAAAQTGLPVCLMHMQGEPKTMQQSPQYQDVLHDVKTFFVENIARCEAAGIKKS
QLLLDPGFGFGKNLSHNYQLLAHLADLHHFGLPLLVGMSRKSMIGQLLNVGPSQRLTGSL
ACAVIAAMQGVHILRVHDVKETVEAMRVVEATQSAREK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttcgccagagatgccgtgctcgatctttctcatccccatgtgatgggaata
ttgaatgtcactcctgactctttttctgatggcggcaagcataacgagttaatccaggcg
ctgacccacgcaaatgagatgattaacgccggagcaacgattatcgatgttggcggtgag
tctacccgtcctggtgccgcagaggtcagcacggagcaggagctggatcgcgttatcccg
gtggtagaagctattgctcaacgttttgaagtctggatctcggtcgatacttccaagcca
gaggtgatccgcgaagcggcctgcgccggggcgcatatcatcaacgatatccgctcactg
caagcacctggcgcgctggctgctgctgcgcaaaccggtttgccagtctgcctgatgcat
atgcagggcgaaccaaaaaccatgcagcagtcgccccagtatcaggacgttctgcacgat
gtgaagactttttttgtcgagaatatcgcccgctgcgaagcggccgggatcaaaaaatcg
cagttgctgctcgacccgggttttggtttcggtaagaatctctcccacaattatcaactg
ctggcgcatttggccgatttgcatcattttggcctgccgctgctagtcggcatgtcgcgt
aaaagtatgattggccagctactgaacgtcgggccatcgcaacgattgaccggcagcctc
gcctgcgcggtgattgccgcgatgcagggcgtccatattctgcgcgtgcatgacgtcaaa
gaaaccgtagaggcgatgcgcgttgtcgaagccacacagtccgcaagggaaaaataa

DBGET integrated database retrieval system