KEGG   Erwinia sp. Ejp617: EJP617_17650Help
Entry
EJP617_17650      CDS       T01935                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
erj  Erwinia sp. Ejp617
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EJP617_17650 (speB)
Enzymes [BR:erj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     EJP617_17650 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1942092..1943015
Genome map
AA seq 307 aa AA seqDB search
MNNTLNHEYDNSLVSNAFGFMRFPLNFQPYDSDAEWVITGVPFDAATSGRPGSRLGPGAI
RQISTNLAWEGCRWPWQFDLRQQLKVIDCGDLVYAFGDAQDFSDKLQAHAEKLLAKGKRM
LTFGGDHYISLPLLRAHAKTFGKMALVHFDAHTDTYSNGPTFDHGTMFYTAPKEGLISPE
HSVQIGIRTEFDPSLGFNVLDAAQVNDRSVDDILAQVKQIVGDLPIYLTFDIDCLDPAHA
PGTGTPVIGGLTSDKASKLIRGLQGMNIVGMDLVEVAPGYDQSDITALAAASLALDMLHV
QAANKIK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaccttaaaccacgagtacgacaactctctggtctccaatgcttttggcttt
atgcgtttcccgcttaacttccagccgtacgacagcgatgccgaatgggtgatcaccggc
gtgccttttgatgcagccacctctggccgaccaggcagccgtctcggccccggtgcaatt
cggcagatctcgaccaatctggcgtgggaaggctgtcgctggccgtggcagttcgatctg
cgtcagcaactgaaagtaatcgattgtggcgatctggtttatgcttttggtgacgcacag
gatttcagcgacaaattgcaggcacatgctgaaaagctgctggcgaagggtaaacgcatg
ctcacctttggcggtgaccactacatcagtctgccactgctgcgtgcgcatgcaaaaacc
ttcggtaagatggcgctggtgcattttgacgcgcatacagatacttactcaaacggcccc
accttcgatcacggcaccatgttttatacggcaccaaaagaaggattgatctctcctgag
cactccgtgcagattggtattcgtaccgaattcgatccgtcactgggctttaacgtgctg
gatgcggcgcaggttaacgatcgtagcgtggacgatatcctggcgcaggtgaagcagatt
gtcggcgacttgcccatctatctgacctttgatattgactgccttgatccggcccatgca
ccgggcaccggcacgccggtgatcggcgggctgaccagcgacaaagccagcaagctgatc
cgtggcctgcagggcatgaacatcgtggggatggatctggttgaagtggctccgggttat
gaccagtctgatataaccgcgctggcggctgccagcctggcattggatatgctgcacgtc
caggctgccaacaagatcaaataa

DBGET integrated database retrieval system