KEGG   Erwinia sp. Ejp617: EJP617_18070Help
Entry
EJP617_18070      CDS       T01935                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
erj  Erwinia sp. Ejp617
Brite
Enzymes [BR:erj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EJP617_18070 (dsbC)
Secretion system [BR:erj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   EJP617_18070 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1980491..1981195
Genome map
AA seq 234 aa AA seqDB search
MKKHYLLLSVLLATASGLAHADDAAIRQSLSKLGLQQTEIQPSPLPGYKTVLSESGVLYV
SDDGKHFIQGPLYDASGGRPVNVTNQLLEKKVDALSKEMIVYKAPKEQHVVTVFTDTTCG
YCHKLHQQMADYNALGITVRYLAFPREGMEGPVAQKMKSIWCAADRNKALDAAMKGEDVK
AADCKIDLAQQFKLGAQYGIQGTPAMLLQDGTLVPGYQGAQELKKFLDGQKNGD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcattacctgttactttcggtgttattagcaacggccagtggactggcgcac
gctgatgatgcagctatccggcagtcgttaagcaaactgggcttacagcagaccgagatc
cagccttcgccactgccgggatataaaaccgtgctgagcgaaagcggtgtgctgtacgtc
agcgatgacggcaaacatttcattcaggggccgctttatgatgccagcggcggccgcccg
gttaacgtcaccaatcagctgctggaaaagaaagtggacgcgctgagcaaagagatgatc
gtctataaagcgccgaaagagcagcatgtggtgacggtatttaccgataccacctgtggc
tactgccataaactgcatcagcagatggcggactacaacgcactggggatcaccgtgcgc
tatctggccttcccgcgtgaaggaatggaaggcccggtagcgcaaaagatgaaatcgatc
tggtgtgccgccgatcgtaacaaggcccttgatgcggcaatgaaaggtgaagacgtgaag
gcggccgactgcaagattgaccttgcacagcaattcaaactgggcgcccagtatggtatt
cagggtactccggccatgctgttgcaggacggcacgctggttcctggctatcagggagcg
caggaactgaagaaattccttgatggccagaaaaatggtgactga

DBGET integrated database retrieval system