KEGG   Erwinia sp. Ejp617: EJP617_18720Help
Entry
EJP617_18720      CDS       T01935                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
erj  Erwinia sp. Ejp617
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:erj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EJP617_18720 (recD)
Enzymes [BR:erj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EJP617_18720 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2070598..2072445
Genome map
AA seq 615 aa AA seqDB search
MTLAEALQLAQHQRLLRPLDVQFACMVATEQQPALMLAAALVSRDAGEGHVCLPLAQLRP
ASFFAGRHPELAQALWQAAGAPEDWQALLLAQSAVSDGQQATPLVVYQQRLYLHRMWQSE
GEIAQFIQRQNYPQDLEEKRVRDTLERYFGQQPDDWQKIAAAVALTRQVAVISGGPGTGK
TTTVAKLLASLIELSPTPPRIELAAPTGKAAARLTESLGKTLRQLQLADRILRSFPLEAT
TLHRLLGALPGSQRMRYHAGNPLHLDVLVVDEASMVDLPMLANLITALPAHARVIFLGDR
DQLASVEAGAVLGDICRCAEEGYSPQRAAELTRLTGCEVAGREDDSASAVRDTICLLRKS
YRFTQSSGIGQLALAVNAGEVKRAEQLFSKGLSDIRHHTLSSSEDYQQLLDDCVAGYREY
LKLLKEGATPGEVLAAFGRFQLLCALREGPFGVAGLNDRIEQTLRLAGLIRRNTALNGKW
YAGRPVMIARNDRALGLFNGDIGIAMPDEKQQLKVYFPLPDGTLKAVQPSRLPPHDTAYA
MTVHKSQGSEFEHTLLVLPNQMMPVLTRELVYTAMTRARQQLTLYADFSVFNSAVKIRTQ
RRSGLVDRLNNRAAF
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggcagaagccttacagctggcacagcaccagcgcttactacgtcctctggac
gtgcagtttgcctgcatggtggcgactgaacagcagcccgcgctgatgctggcggcagcg
ctggtcagccgcgacgccggggaaggtcatgtttgtctgccgttggcacagctgcggcct
gcctctttttttgccgggcgccatccggagctggcacaggcactgtggcaggctgcgggc
gcgccggaggactggcaggcgctgctgctggcacaaagcgcggtcagcgacggccagcag
gccacgccgctggtggtgtatcaacagcggctttatctgcatcgtatgtggcaaagcgag
ggggaaattgcgcagtttattcagcgtcagaattatcctcaggatctggaagaaaaacgg
gtgcgtgatacgctggagcgttattttggccagcagcccgatgactggcaaaagatcgcc
gcagcggtagcgctgacgcgccaggtggcggtgatctccggcgggcctggaaccggcaaa
accaccaccgtggccaagctgcttgccagcctgattgaactatcgcccacgccaccgcgt
atcgaactggcggcaccgaccggcaaggcggcggcgcggctgacggaatcgctcggtaaa
acgctgcgacagctgcagctggccgatcgcatcctgagaagtttcccattggaggcgacg
acgctgcatcgcctgctgggggcgctgccgggcagtcagcgcatgcgctatcatgccgga
aatccactgcatcttgacgtactggtcgtcgatgaagcctcaatggtggatctcccgatg
ctggctaacctgattaccgctttgcccgctcatgcgcgggttatctttctcggtgaccgc
gatcagctggcttcagtcgaagccggagcggtgctgggtgatatttgccgctgtgcggaa
gagggctacagcccgcagcgtgccgcagagctgacgcgtcttaccggctgcgaggtggcg
gggcgcgaagatgatagcgcctccgcggtgcgcgatacgatctgcctgctgcgtaaaagc
tatcgttttacgcaatcatccggcatcggccagctggcgctggcggttaatgcgggtgag
gtaaaaagggcagagcagttattcagcaagggtttaagcgatatccgccaccatacgcta
agcagcagcgaggactatcagcagctgctggacgactgtgttgcagggtaccgtgaatac
ctgaaattgctgaaggaaggagccacgccaggcgaagtcctggccgcatttggccgtttc
cagctgctgtgcgctctgcgcgaagggccgtttggtgttgcagggctgaatgaccgtatt
gaacagacgctgcgcctggcggggcttatccgccgcaataccgcactcaacggcaaatgg
tacgctggtcgcccggtgatgattgcgcgcaatgaccgtgcgctaggcctgtttaacggt
gatatcggcatcgcgatgccggatgaaaaacagcagctgaaagtgtattttccgttaccg
gatggcactctcaaagcggtgcagcccagccgcctgccgccgcatgatacggcctatgcc
atgacggtgcacaagtcgcagggatccgagtttgagcacacgctgctggttttacctaac
cagatgatgccggtactgacccgtgagctggtttataccgccatgacccgcgccagacag
cagttaaccctttatgccgacttttcggtgttcaacagtgcggtgaagatacgcacgcag
cggcgtagtgggctggtggatcggctgaataacagggcagctttttag

DBGET integrated database retrieval system