KEGG   Erwinia sp. Ejp617: EJP617_19190Help
Entry
EJP617_19190      CDS       T01935                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
erj  Erwinia sp. Ejp617
Brite
Enzymes [BR:erj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     EJP617_19190 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2121586..2122176
Genome map
AA seq 196 aa AA seqDB search
MRLQGIDDERLLLAIGDVPRARFIDEAFEHKAWENTALPIGSGQTISQPYMVAKMTSLLA
LTPASRVLEIGTGSGYQTAILAHLAGHVCSVERIKGLQWQAKRRLKQLDLHNVSTRHGDG
WLGWPSRGPFDAIIVTAAPPEIPDALMSQLVDGGIMVLPVGEENQVLKRIHRKGDEFIVD
TIEPVRFVPLVKGDLA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtttgcagggcattgatgacgagcggctgttactggctatcggtgacgtgccgcgc
gcgcgctttattgatgaagcctttgaacacaaagcctgggaaaataccgcgttgccgatt
ggcagcgggcagacaatttcccagccctacatggtggccaaaatgacctcgttgctggcg
ctgaccccggcatcgcgcgtgttggaaatcggcaccggctccggctaccagacggcaatc
cttgcgcatctggcagggcatgtttgttcggttgagcgcatcaaagggctgcagtggcag
gctaaacgccgtctgaagcagctggatctgcacaatgtttccacccgacatggcgatggc
tggctgggctggccatcacgcggcccctttgacgcgattatagtgacggctgccccgccg
gaaataccggatgccctgatgtcacagcttgttgatggcgggattatggtcttgccagtt
ggggaagaaaaccaggtgctgaaacgtattcaccgtaagggtgatgagtttattgtcgac
accattgagccggtgcgttttgtgccgctggtgaaaggcgaccttgcgtga

DBGET integrated database retrieval system