KEGG   Erwinia sp. Ejp617: EJP617_20050Help
Entry
EJP617_20050      CDS       T01935                                 

Definition
methionine salvage pathway protein E-2/E-2
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
erj  Erwinia sp. Ejp617
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EJP617_20050
Enzymes [BR:erj01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     EJP617_20050
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     EJP617_20050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2224744..2225286
Genome map
AA seq 180 aa AA seqDB search
MSALTIFTDSEATTPVWYSIDAAEMAEKLRSKGVRFERWHADRDLGDNPDPETVIDAYQH
AIERLVAEKGYQSWDVISMRADNPQKEALRSKFLSEHTHGEDEVRFFVEGAGLFCLHLDG
HIFQVLCEKNDLISVPAGTPHWFDMGSSPHFTAIRIFDNQEGWIANFTGDPIADGYPRLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactgactatttttaccgatagtgaagcgaccaccccggtgtggtacagcatc
gatgccgctgagatggctgagaagctgcgcagcaaaggcgtgcgctttgaacgctggcac
gccgaccgcgatctgggcgataaccctgatccagagacggtaatcgatgcctatcagcat
gctatcgagcggctggtagcggagaaaggctatcagagctgggacgtgatcagcatgcgt
gccgacaacccgcagaaggaggcgttgcgcagcaagtttctctctgaacatactcacgga
gaagatgaagtgcgcttctttgtcgaaggggcggggctgttctgcctgcatcttgacggg
catattttccaggtgctgtgtgaaaaaaatgacctgatctcggttccggcagggactcca
cactggtttgatatgggatcctcaccgcactttacggccatccgcatcttcgacaatcag
gaaggttggatcgctaattttaccggcgatccgattgcggacggctatccgcgcctgcct
taa

DBGET integrated database retrieval system