KEGG   Erwinia sp. Ejp617: EJP617_20190Help
Entry
EJP617_20190      CDS       T01935                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
erj  Erwinia sp. Ejp617
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:erj01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:erj00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2239423..2240625
Genome map
AA seq 400 aa AA seqDB search
MAFSPFSPAGCWLQAQQLLKRFFVLFFTKWQEIMSSSQTLVVKLGTSVLTGGSRRLNRAH
IVELVRQCAQQHAAGHRIVIVTSGAMAAGREHLGYPELPPTIASKQLLAAVGQSRLIQLW
EQLFSIYGIHIGQMLLTRADLEDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVG
DNDNLSALAAILAGADKLLLLTDQQGLFTADPRDNPQAELIRDVRGIDDNLRALAGDSVS
GLGTGGMTTKLQAADIACRAGIDTIIAAGSRAGVIGDVIASNQVGTCFHALETPLENRKR
WIFGAPPAGELVVDDGALSAILERGSSLLPKGIREIIGNFSRGEVIRIRSLQGRDVAHGV
SRYNSDAMRMIAGHHSQQIGEILGYEYGPVAVHRDDMIVS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctttttcacccttttcccctgctggctgttggcttcaggcacaacaactgctaaaa
cgtttctttgtactcttttttacgaaatggcaggaaataatgagcagcagccagaccctg
gtggtgaaactggggaccagcgttttgaccggcggttcacgtcggctgaaccgggcgcat
atcgtcgagctggtgcggcagtgcgcccagcagcacgcggcggggcaccggattgtgatc
gttacctctggcgcgatggcggccgggcgagagcatctgggttacccggaattgccgccg
accatcgcttccaagcagctgctggctgcggtggggcagagccgtctgatccaactgtgg
gaacaactgttctctatctacggtattcatatcggccagatgttgctgacgcgtgccgac
ctggaagatcgtgagcgctttctcaacgcccgcgatacgctgcgcgcgctgctcgataac
catattgtcccggtgattaatgagaatgatgcggtcgccaccgccgagattaaggtgggc
gataacgataacctgtcggcgctggccgctattctcgccggagccgataagctgctgctg
ctgaccgatcagcaggggctgttcaccgccgatccgcgcgataatccgcaggcagaactg
atccgtgacgtcaggggcattgacgacaatctgcgtgcgctggccggggatagcgtttcc
ggtcttggcaccggaggtatgacgaccaagttgcaggcggcggatattgcctgccgtgcc
ggcatcgatactattattgcggcgggtagccgtgcgggcgtgattggcgatgtgatcgct
tccaatcaggtgggaacctgcttccatgcgctggaaaccccgctggaaaaccgtaaacgc
tggatcttcggcgcgcctcctgccggtgaactggtggtggacgacggagcgctgtcggcg
atccttgaacgcggcagttcgctgttgccaaaaggtatccgtgaaatcatcggtaacttc
tcgcgtggtgaagtgatccgcatccgtagcctgcaggggcgcgatgtggctcacggcgta
tcgcgctacaacagcgacgctatgcgcatgattgccgggcaccattcccagcagatcggc
gaaattttaggttatgaatatggtccggtggctgttcatcgcgacgatatgattgtcagc
taa

DBGET integrated database retrieval system