KEGG   Erwinia sp. Ejp617: EJP617_21450Help
Entry
EJP617_21450      CDS       T01935                                 

Gene name
recR
Definition
Recombination protein
Orthology
K06187  
recombination protein RecR
Organism
erj  Erwinia sp. Ejp617
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:erj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2356561..2357166
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLETLMESLRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDICTICANPRRQQNGLICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEKESIQEVILATNPTVEGEATANYIASLCEQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRQKFKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccactcctcgaaacattaatggagtcgctgcgttgcctgccgggcgtt
gggcctaagtctgctcaacgcatggcttttcagctgttacaacgcgatcgcagcggcggg
atgcgcctggcccaggcgttgacgcgagcgatgtcggaaatcgggcactgtgccgactgc
cgtaccttcactgaacaggatatttgcactatttgcgccaatccacggcgtcagcagaat
gggctgatatgtgtagtggaaagcccggcagatatccacgccatcgagcaaaccgggcag
ttcgctggccgttacttcgttctgatggggcatctgtcgccgttggatggtatcgggcca
gatgacattggcctcgaccggctggagcagaggctggaaaaagaatcgattcaggaagtg
atcctcgccactaatccgacggtggaaggtgaggcgaccgctaactacatcgccagcctg
tgcgaacagtacggcgtggacgccagccgcattgctcatggtgttccggtgggcggtgaa
ctggaaatggtcgatggcaccacgctgtcgcactcactggccggacgtcagaagttcaaa
ttctga

DBGET integrated database retrieval system