KEGG   Erwinia sp. Ejp617: EJP617_21800Help
Entry
EJP617_21800      CDS       T01935                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
erj  Erwinia sp. Ejp617
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EJP617_21800 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EJP617_21800 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    EJP617_21800 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EJP617_21800 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EJP617_21800 (adhP)
   00626 Naphthalene degradation
    EJP617_21800 (adhP)
Enzymes [BR:erj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EJP617_21800 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2390754..2391770)
Genome map
AA seq 338 aa AA seqDB search
MKAAVVTHDHQVDVVEKTLRALQHGEALLTMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVKSVGPGVTSLKPGDRASVAWFFKGCGHCEYCNSGIETLCREVVNAGYTADGGMAEE
CIVVADYAVKVPDGLDPAVASSITCAGVTTYKAVKISGISPGKWLVVYGLGGLGNLALQY
AKNVFNAKVIAVDVSDAQLKFAEEMGADMVINSRNEDAARLIQQRTGGAHAAVVTAVAKA
AFNSAVDAMRAGGRIVAVGLPPESMSLNIPRLVLDGIQVVGSLVGTREDLAEAFQFAAEG
KVVPKVTRRPLQDINAIFHDMESGKIVGRMVIDFNSTH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgtcactcacgatcatcaggttgatgtggtagagaaaaccctccgc
gcgctgcagcatggtgaagccctgctcaccatggagtgttgcggggtctgtcataccgac
ctgcacgttaaaaacggagatttcggcgataaaactggcgttatccttgggcacgaaggg
attggcgtagtcaaatctgtcggtccgggcgtgacctccctcaagcccggcgaccgtgcc
agcgtggcgtggtttttcaaaggctgcggtcactgtgaatactgcaacagcggcattgaa
accctgtgccgtgaagtcgtcaacgccggttataccgccgatggcggcatggccgaagag
tgtatcgtggtggcggattatgccgttaaggtgcctgacggtctcgatcctgcggtcgcc
agcagcattacctgcgccggtgtcactacctacaaggcggtgaaaatctccggtatttct
cccggaaaatggctggttgtctatggccttggcggtctgggcaatctggcgctgcagtac
gcaaaaaatgtgtttaatgccaaagtcatcgccgttgacgtcagcgatgcccagctgaaa
tttgccgaagagatgggggccgatatggtgatcaactcgcgtaatgaagacgcggcacgg
ctgatccagcaacgcacgggtggcgcacatgctgccgtggtaacagccgttgccaaagcg
gcgtttaattctgcggtggatgcgatgcgcgccggtggccgtatcgtggcagtgggcctg
ccgccggaatcgatgagcctgaatatcccgcgtctggtgctggacggcatccaggtcgtc
ggctcgctggtcggcacgcgtgaagatttagctgaagctttccagttcgcggctgaaggc
aaagttgtacccaaagtcactcgccgcccgctgcaggacatcaacgcgatcttccatgac
atggaaagcggaaaaatcgttggccgcatggtgattgattttaacagtacccattaa

DBGET integrated database retrieval system