KEGG   Erwinia sp. Ejp617: EJP617_23120Help
Entry
EJP617_23120      CDS       T01935                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
erj  Erwinia sp. Ejp617
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EJP617_23120 (gpmA)
   01230 Biosynthesis of amino acids
    EJP617_23120 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EJP617_23120 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EJP617_23120 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EJP617_23120 (gpmA)
Enzymes [BR:erj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EJP617_23120 (gpmA)
Exosome [BR:erj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EJP617_23120 (gpmA)
  Exosomal proteins of melanoma cells
   EJP617_23120 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2532076..2532828)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGQLLKKEGFTFDFAYTSVL
KRAIHTLWNILDEVDQVWLPVEKSWRLNERHYGALQGLDKAETANKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYASLSAEQLPTTESLALTIDRVLPYWNESILPRMKSGEKVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDESFKPIRHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaagctggttctggtacgtcacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggccgcaccgaggcaaaagcc
gccggtcagctgctgaagaaagaaggttttaccttcgattttgcttacacttctgtgctg
aaacgtgccattcataccttgtggaacatcctggatgaagttgaccaggtgtggctgccg
gtagagaagtcatggcgtcttaacgagcgtcactacggtgcgctgcaaggactggataag
gctgaaaccgctaacaaatacggtgacgagcaggttaagcagtggcgccgtggctttgcc
gttaccccacctgagctggatcgtgccgatgagcgtttccccggtcacgatcctcgctat
gcttcgttgtccgctgaacagttgccgacgaccgaaagcctggcgctgaccattgaccgc
gtgctgccatactggaatgaatctattctgccgcgtatgaaaagcggtgagaaagtgatc
attgctgcgcacggtaactccttgcgcgcgctggtcaaatacctggacaatatgagtgaa
gaagagatcctcgaattaaatatccccaccggcgtaccgctggtctatgagttcgatgaa
agctttaagccgatcagacactactacctgggcgatgcagatgaaatcgccgctaaggca
gctgccgtagctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system