KEGG   Erwinia sp. Ejp617: EJP617_23130Help
Entry
EJP617_23130      CDS       T01935                                 

Gene name
galM
Definition
(GenBank) Galactose 1-epimerase (Mutarotase)
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00010  Glycolysis / Gluconeogenesis
erj00052  Galactose metabolism
erj01100  Metabolic pathways
erj01110  Biosynthesis of secondary metabolites
erj01120  Microbial metabolism in diverse environments
erj01130  Biosynthesis of antibiotics
Module
erj_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EJP617_23130 (galM)
   00052 Galactose metabolism
    EJP617_23130 (galM)
Enzymes [BR:erj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EJP617_23130 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADP11994
UniProt: E3DKV6
Position
complement(2532982..2534016)
Genome map
AA seq 344 aa AA seqDB search
MLTSGSSTADGSGYQVTTLRNGNGMVATFMDQGATWLSARVPMGDGSVREALLGCASPSD
YARQSAYLGATVGRYANRIAYAQFQYQGIPLPLLANQGKHQLHGGSDGFNQRRWQIVSHS
NNEVEYRLESADGDQGFPGMLSVSLCYRLDDDNALSISYHASVDKPCPVNLTNHAYFNLD
GVQGDARQHRLLIKADRYLPVDGEGIPNAPLKAVDGTSFDFRRAKSVAQDFMQDDDQRAV
QGYDHAFLLNAAAGEAAASLWSADGKLRLDVFTSAPALQLYSGNHLAGTPARDRGVYDSF
QGIALESEFLPDSPNHPEWPQPDCWLQPGESYQSVTRYQLTALD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgtccgggtcatccacagctgacggttctggctaccaggttaccactttgcgt
aacggtaacggcatggtcgccacctttatggaccagggtgcaacctggctttctgcccgc
gtgccgatgggcgacggcagcgtgcgtgaagcgctgctgggctgtgcttcaccgtcagac
tatgcacgacagtcggcttacctgggcgctaccgtaggccgctacgccaaccgcattgcc
tacgcgcagttccagtaccagggtatcccccttccgctgctggcaaaccagggcaaacat
cagctgcacggcggctctgatggcttcaaccagcgccgctggcagattgtcagccacagc
aataacgaagtggagtatcggctcgaatcggcggatggcgatcagggtttccccggcatg
ctgtcagtttcgttgtgctatcgccttgacgacgataatgcgctatcaattagctatcac
gcctcggtagataaaccctgcccggttaatctcaccaatcatgcctattttaatctggat
ggcgttcagggtgatgcgcgccagcatcgccttttaatcaaggcagatcgctatctgccc
gttgacggcgaaggcattcccaacgcaccgttgaaagccgtggacggcaccagcttcgat
ttccgccgggcaaaaagcgtggcacaggattttatgcaggatgatgaccagcgtgcagtg
cagggttacgatcacgctttcctgctgaacgcggcagcaggcgaagcggccgcctcgctt
tggtctgctgacggcaaattacggctggatgtgttcaccagcgctccggcattgcagctg
tacagcggcaatcacctggcaggtactccggcacgcgataggggtgtgtatgattctttt
cagggcattgcactggaaagcgagttcttacccgattcgcctaaccacccagagtggccg
cagccagactgctggctacagcccggtgaatcatatcagtcggtgacgcgctatcagctg
acggcacttgactga

DBGET integrated database retrieval system