KEGG   Erwinia sp. Ejp617: EJP617_25890Help
Entry
EJP617_25890      CDS       T01935                                 

Gene name
ycfO
Definition
putative glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
erj  Erwinia sp. Ejp617
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EJP617_25890 (ycfO)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    EJP617_25890 (ycfO)
Enzymes [BR:erj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EJP617_25890 (ycfO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2822823..2823854
Genome map
AA seq 343 aa AA seqDB search
MGPVMLDVLGCELDAEEREILQHPLTGGLILFSRNYHDPAQLRELVRQIRSASRHRLVVA
VDQEGGRVQRFREGFTRLPAMQAFAALNPSTEAEKLAQQAGWLMASEMIAMDIDISFAPV
LDIGHGSAAIGERSFHEDPAIALRLARCFIRGMHEAGMKTTGKHFPGHGAVSADSHKETP
RDTRSEAEIRQHDMPIFQQLIAEQALDAIMPAHVIYTQVDPRPASGSPHWLKTVLRQELG
YDGVIFSDDLSMEGAAIMGSYPERARAALDAGCDMILVCNNRAGAVSVLDNLPVMVSERV
ARLYHRGNLTLQQLIGSPRWKETSAALARLQDRWLIHKAGEGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtccggtaatgttagacgtgctcggttgcgagctggatgcggaagaacgtgaaatc
ttacagcatccgctgacggggggactgatcctgttcagccgcaactatcacgatccggcg
cagctgcgggagctggtgcgccagatccgcagcgcatcgcgtcatcgtctggtggtggcg
gtggatcaggaaggcgggcgcgtacagcgcttccgtgaaggatttacccggctgcccgcc
atgcaggcgtttgcggcgcttaacccatcgactgaggccgaaaagctggcgcagcaggct
ggctggctgatggcgtcagagatgatcgccatggatattgatatcagctttgctccggta
ctggacattggccacggcagcgcggctatcggcgagcgctcattccatgaagatccggcc
atcgccttacggctggctcgctgttttattcgcgggatgcacgaagcaggcatgaaaacc
accggcaagcattttcccgggcatggtgccgtcagtgcagattcacataaagagaccccg
cgcgacacgcgcagcgaagcggaaatccgccagcatgatatgccgatctttcagcagctg
atagcggaacaggcgctggatgccattatgcccgcccacgttatctatacgcaggtggac
ccgcgtcctgccagcggctccccgcactggttaaaaaccgtgttgcgtcaggagctgggc
tatgacggcgtgattttctccgacgatctgtcaatggagggcgcagcgattatgggcagc
taccccgagcgcgcccgggccgcgctggacgccggatgcgatatgatcctggtgtgtaat
aaccgggctggcgcggtcagcgtgttggataatctgccggtaatggtgtctgaaagggtt
gcccggctgtaccaccgggggaaccttaccctgcaacagcttatcggctcaccgcgctgg
aaggaaaccagcgccgcgttggcccggctacaggatcgctggctaatccataaagcgggt
gaaggcagctaa

DBGET integrated database retrieval system