KEGG   Erwinia sp. Ejp617: EJP617_27990Help
Entry
EJP617_27990      CDS       T01935                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
erj  Erwinia sp. Ejp617
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:erj00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:erj00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3033840..3034412
Genome map
AA seq 190 aa AA seqDB search
MSVSKTGETMNLYETELITLDGEKTSLAQWQGDVLLVVNVASKCGLTPQYEALENLQKTL
HHQGLTVLGFPCNAFLEQEPGSEAEIKTFCRTTYGVTFPMFSKINVNGPQRHPLYAQLIA
AQPEATAPENSGFAERMASKGRAPKQYGDALWNFEKFLIARDGRVVARFSPDMAPNDPLL
LASVEKALAK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtcagcaaaactggagaaacaatgaatctgtatgaaaccgaactgattacgctg
gacggcgagaaaaccagcctggcccagtggcagggagacgtgctgctggtggtaaacgtg
gcttcaaaatgtgggctaacaccgcagtatgaagcgttggagaatttacagaagacgctg
caccatcaggggctgacggtactgggattcccttgcaatgcctttctggagcaggagccg
ggcagcgaagccgaaataaaaacgttttgtcgcaccacctacggtgtgaccttcccgatg
tttagcaaaatcaatgttaacggcccgcagcggcacccactttacgcgcagctgatagcg
gcccagcctgaagctaccgcgcctgaaaacagcggatttgctgaacgtatggccagtaaa
ggtcgtgcgccgaaacagtatggtgatgccctgtggaacttcgagaagtttctcatcgct
cgggatggacgggtagttgcacgtttctctcctgatatggcgcccaacgatccgctgctg
ctggcctcggtcgaaaaggcgctggccaaataa

DBGET integrated database retrieval system