KEGG   Erwinia sp. Ejp617: EJP617_27990Help
Entry
EJP617_27990      CDS       T01935                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
erj  Erwinia sp. Ejp617
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    EJP617_27990 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    EJP617_27990 (btuE)
Enzymes [BR:erj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EJP617_27990 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3033840..3034412
Genome map
AA seq 190 aa AA seqDB search
MSVSKTGETMNLYETELITLDGEKTSLAQWQGDVLLVVNVASKCGLTPQYEALENLQKTL
HHQGLTVLGFPCNAFLEQEPGSEAEIKTFCRTTYGVTFPMFSKINVNGPQRHPLYAQLIA
AQPEATAPENSGFAERMASKGRAPKQYGDALWNFEKFLIARDGRVVARFSPDMAPNDPLL
LASVEKALAK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtcagcaaaactggagaaacaatgaatctgtatgaaaccgaactgattacgctg
gacggcgagaaaaccagcctggcccagtggcagggagacgtgctgctggtggtaaacgtg
gcttcaaaatgtgggctaacaccgcagtatgaagcgttggagaatttacagaagacgctg
caccatcaggggctgacggtactgggattcccttgcaatgcctttctggagcaggagccg
ggcagcgaagccgaaataaaaacgttttgtcgcaccacctacggtgtgaccttcccgatg
tttagcaaaatcaatgttaacggcccgcagcggcacccactttacgcgcagctgatagcg
gcccagcctgaagctaccgcgcctgaaaacagcggatttgctgaacgtatggccagtaaa
ggtcgtgcgccgaaacagtatggtgatgccctgtggaacttcgagaagtttctcatcgct
cgggatggacgggtagttgcacgtttctctcctgatatggcgcccaacgatccgctgctg
ctggcctcggtcgaaaaggcgctggccaaataa

DBGET integrated database retrieval system