KEGG   Erwinia sp. Ejp617: EJP617_30240Help
Entry
EJP617_30240      CDS       T01935                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
erj  Erwinia sp. Ejp617
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EJP617_30240 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EJP617_30240 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EJP617_30240 (trpB)
Enzymes [BR:erj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EJP617_30240 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3282067..3283257
Genome map
AA seq 396 aa AA seqDB search
MTRLNPYFGEFGGMYVPQILMPALLQLEDAFISAQSDPSFQAEFTDLLKNYAGRPTALTL
CKNVTKGSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGAATLKDACNEALRDWSGSY
ETTHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILQQEGRLPDAVIACVGGGSNAIGMF
ADFIDESGVELIGVEPGGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTTDGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRANYVSITDEEALDAFKTLCRSEGIIPALESSHALAHALKM
ARENPEKEQLLVVNLSGRGDKDIFTVHDILTAKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtttaaacccttattttggcgagtttggtggcatgtacgtgccgcagatcctg
atgcctgccctgcttcaactggaagatgcgtttatcagcgcgcagagcgatccctcattc
caggccgagtttaccgacctgctgaaaaattacgctggccgcccaaccgcgctgacgctg
tgtaaaaacgtgactaagggcagcaaaacgcgcctttatctgaaacgtgaagacctgctg
cacggcggcgcgcacaaaaccaatcaggtactgggccaggcgctgctggcaaagcgcatg
ggcaaaaacgaaattattgctgagaccggtgccggtcagcacggcgttgcctcggcgctg
gcctgcgcgctgctcggcctgaaatgccgcatctatatgggtgcgaaggatattgagcgt
cagtcgcctaacgtatttcgtatgcgtctgatgggtgcggaggtgatcccggtgcacagc
ggtgccgccacgctaaaagacgcttgtaatgaggcgctgcgcgactggtccggcagctac
gaaaccacccactatatgctgggtacggcggcaggcccgcatccattcccgaccatcgtg
cgcgaattccagcgcatgattggggaggagactaaagctcagatcctacagcaggaaggt
cgcctgccggatgccgtcatcgcctgcgttggcggggggtctaacgccatcggcatgttt
gccgactttattgatgagtcgggtgtggaactgattggcgtcgagccaggcggtcacggt
attgaaagcggcgagcatggcgctccgctcaagcacgggcgagtcggtatttattttggt
atgaaatcaccgatgatgcagaccacagacgggcaaattgaagagtcttattctatttca
gccggtctcgacttcccttcagtcggcccgcagcatgctcaccttaacagtatcggccgg
gcgaactacgtctcgattaccgatgaagaagcgctggatgccttcaagacgttgtgccgc
agcgaagggatcatcccggcgctggaatcctcacatgcgctggcccatgcactgaaaatg
gcacgcgaaaatcctgaaaaagagcagctgctggtggtcaatctttccggccgtggtgac
aaagatattttcaccgtgcacgacatccttaccgctaagggagaaatctga

DBGET integrated database retrieval system