KEGG   Erwinia sp. Ejp617: EJP617_30240Help
Entry
EJP617_30240      CDS       T01935                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00260  Glycine, serine and threonine metabolism
erj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
erj01100  Metabolic pathways
erj01110  Biosynthesis of secondary metabolites
erj01130  Biosynthesis of antibiotics
erj01230  Biosynthesis of amino acids
Module
erj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EJP617_30240 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EJP617_30240 (trpB)
Enzymes [BR:erj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EJP617_30240 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADP12705
UniProt: E3DGL8
Position
3282067..3283257
Genome map
AA seq 396 aa AA seqDB search
MTRLNPYFGEFGGMYVPQILMPALLQLEDAFISAQSDPSFQAEFTDLLKNYAGRPTALTL
CKNVTKGSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGAATLKDACNEALRDWSGSY
ETTHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILQQEGRLPDAVIACVGGGSNAIGMF
ADFIDESGVELIGVEPGGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTTDGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRANYVSITDEEALDAFKTLCRSEGIIPALESSHALAHALKM
ARENPEKEQLLVVNLSGRGDKDIFTVHDILTAKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtttaaacccttattttggcgagtttggtggcatgtacgtgccgcagatcctg
atgcctgccctgcttcaactggaagatgcgtttatcagcgcgcagagcgatccctcattc
caggccgagtttaccgacctgctgaaaaattacgctggccgcccaaccgcgctgacgctg
tgtaaaaacgtgactaagggcagcaaaacgcgcctttatctgaaacgtgaagacctgctg
cacggcggcgcgcacaaaaccaatcaggtactgggccaggcgctgctggcaaagcgcatg
ggcaaaaacgaaattattgctgagaccggtgccggtcagcacggcgttgcctcggcgctg
gcctgcgcgctgctcggcctgaaatgccgcatctatatgggtgcgaaggatattgagcgt
cagtcgcctaacgtatttcgtatgcgtctgatgggtgcggaggtgatcccggtgcacagc
ggtgccgccacgctaaaagacgcttgtaatgaggcgctgcgcgactggtccggcagctac
gaaaccacccactatatgctgggtacggcggcaggcccgcatccattcccgaccatcgtg
cgcgaattccagcgcatgattggggaggagactaaagctcagatcctacagcaggaaggt
cgcctgccggatgccgtcatcgcctgcgttggcggggggtctaacgccatcggcatgttt
gccgactttattgatgagtcgggtgtggaactgattggcgtcgagccaggcggtcacggt
attgaaagcggcgagcatggcgctccgctcaagcacgggcgagtcggtatttattttggt
atgaaatcaccgatgatgcagaccacagacgggcaaattgaagagtcttattctatttca
gccggtctcgacttcccttcagtcggcccgcagcatgctcaccttaacagtatcggccgg
gcgaactacgtctcgattaccgatgaagaagcgctggatgccttcaagacgttgtgccgc
agcgaagggatcatcccggcgctggaatcctcacatgcgctggcccatgcactgaaaatg
gcacgcgaaaatcctgaaaaagagcagctgctggtggtcaatctttccggccgtggtgac
aaagatattttcaccgtgcacgacatccttaccgctaagggagaaatctga

DBGET integrated database retrieval system