KEGG   Erwinia sp. Ejp617: EJP617_30250Help
Entry
EJP617_30250      CDS       T01935                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
erj  Erwinia sp. Ejp617
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EJP617_30250 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EJP617_30250 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EJP617_30250 (trpA)
Enzymes [BR:erj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EJP617_30250 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3283257..3284063
Genome map
AA seq 268 aa AA seqDB search
MDRYDLCFKRLAAKQEGAFVPFVTLGDPTPKLSLQIIDALVAGGADALELGIPFSDPLAD
GPTIQNANLRAFAAGVTPEQCFELLAAIREKYPQLPIGLLMYANLVFSNGIDNFYARCQQ
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNASDDLLREIASHGRGYTYLLSRA
GVTGSETRASLPLKHLVDKLREYHAAPALQGFGISEASQVQQAIAAGARGAISGSAVVKI
IEKHLTEPAVMLSELTAFAASLKDGTRC
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgctacgacctctgttttaaacgcctggccgcaaagcaggaaggggcgtttgtc
cccttcgtcaccctcggcgacccgacgcccaaactgtcgttacagattatcgatgcgctg
gtggcaggcggtgctgatgcgcttgagctgggcattcccttttccgacccgctggcagat
ggccccactatccagaatgctaacctgcgcgccttcgctgccggagtcacgccggagcaa
tgttttgaattgctggcggcgatccgtgagaaatacccacagctgcccattggcctgctg
atgtacgcaaacctggtcttctccaacggtattgataacttctatgcccgttgccagcag
gttggcgttgattcggtgctggtggccgatgtaccggttgaagagtctgccccgttccgc
caggcggccatgcgacataacgtcgcgcctatattcatctgcccgccaaacgccagtgac
gatttactgcgtgaaattgcttctcacggccgggggtatacctacctgctgtcgcgtgcc
ggggtgaccggttcagaaacccgcgccagtctgccgcttaaacacctggtggataaactg
cgcgaatatcatgcggccccggcgctgcagggctttggtatttccgaagcctcacaggtg
cagcaggcgattgctgccggggcgagaggggcgatttcaggttctgccgtggtcaaaatc
attgagaaacatctgaccgagcctgcggtgatgttgtcagaactgaccgcttttgccgcc
agcctgaaagacggcacccgatgctaa

DBGET integrated database retrieval system