KEGG   Erwinia sp. Ejp617: EJP617_30250Help
Entry
EJP617_30250      CDS       T01935                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00260  Glycine, serine and threonine metabolism
erj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
erj01100  Metabolic pathways
erj01110  Biosynthesis of secondary metabolites
erj01130  Biosynthesis of antibiotics
erj01230  Biosynthesis of amino acids
Module
erj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EJP617_30250 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EJP617_30250 (trpA)
Enzymes [BR:erj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EJP617_30250 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADP12706
UniProt: E3DGL9
Position
3283257..3284063
Genome map
AA seq 268 aa AA seqDB search
MDRYDLCFKRLAAKQEGAFVPFVTLGDPTPKLSLQIIDALVAGGADALELGIPFSDPLAD
GPTIQNANLRAFAAGVTPEQCFELLAAIREKYPQLPIGLLMYANLVFSNGIDNFYARCQQ
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNASDDLLREIASHGRGYTYLLSRA
GVTGSETRASLPLKHLVDKLREYHAAPALQGFGISEASQVQQAIAAGARGAISGSAVVKI
IEKHLTEPAVMLSELTAFAASLKDGTRC
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgctacgacctctgttttaaacgcctggccgcaaagcaggaaggggcgtttgtc
cccttcgtcaccctcggcgacccgacgcccaaactgtcgttacagattatcgatgcgctg
gtggcaggcggtgctgatgcgcttgagctgggcattcccttttccgacccgctggcagat
ggccccactatccagaatgctaacctgcgcgccttcgctgccggagtcacgccggagcaa
tgttttgaattgctggcggcgatccgtgagaaatacccacagctgcccattggcctgctg
atgtacgcaaacctggtcttctccaacggtattgataacttctatgcccgttgccagcag
gttggcgttgattcggtgctggtggccgatgtaccggttgaagagtctgccccgttccgc
caggcggccatgcgacataacgtcgcgcctatattcatctgcccgccaaacgccagtgac
gatttactgcgtgaaattgcttctcacggccgggggtatacctacctgctgtcgcgtgcc
ggggtgaccggttcagaaacccgcgccagtctgccgcttaaacacctggtggataaactg
cgcgaatatcatgcggccccggcgctgcagggctttggtatttccgaagcctcacaggtg
cagcaggcgattgctgccggggcgagaggggcgatttcaggttctgccgtggtcaaaatc
attgagaaacatctgaccgagcctgcggtgatgttgtcagaactgaccgcttttgccgcc
agcctgaaagacggcacccgatgctaa

DBGET integrated database retrieval system