KEGG   Erwinia sp. Ejp617: EJP617_30500Help
Entry
EJP617_30500      CDS       T01935                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
erj  Erwinia sp. Ejp617
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EJP617_30500 (galU)
   00052 Galactose metabolism
    EJP617_30500 (galU)
   00500 Starch and sucrose metabolism
    EJP617_30500 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EJP617_30500 (galU)
Enzymes [BR:erj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EJP617_30500 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3304373..3305281)
Genome map
AA seq 302 aa AA seqDB search
MSAYNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEIQSICPPHVTIMQVRQGLAKGLGHAVM
CAWPVIGNEPVAVILPDVILDEYESDLSKDNLAEMIRRFDETGHSQIMVEPVSDVTAYGV
VDCQGAQLSPGDSAPMVGVVEKPKADKAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDSIAMLMEKETVEAYHLKGASHDCGNKLGYMQAFVEYGVRHETLGSDFKAWLESAVGN
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataactcaaaagtaaaaaaagcggttatcccggttgccggtttgggaacg
cgtatgttgcctgctactaaagcgattccgaaagagatgttgccactggttgataagccg
ttaattcagtatgtcgttaacgagtgtattgctgctgggatcaacgaaatcgtgctggtt
acgcactcttccaagaactcaattgaaaaccacttcgacaccagcttcgagctggaagcc
atgctggaaaaacgtgttaaacgtcagctgctggaagagattcagtcaatctgtccacca
cacgttaccattatgcaggttcgtcaggggctggctaaaggtcttggccatgcggttatg
tgtgcatggccggtcattggtaacgagccggtagccgttatcctgccggatgtaattctg
gatgaatacgaatcagatctgtcaaaagataacctggcagaaatgatccgccgcttcgat
gaaaccggccacagccagatcatggttgaacccgtttctgacgtcaccgcttacggtgtg
gtggattgccagggcgcgcaattaagcccgggcgacagcgcgccaatggtcggcgtggtg
gaaaaacctaaagccgataaagccccttcaaatctggcagtcgtcgggcgttacgtgctg
tctgctgatatctggccactgctggctaaaactcctccaggtgccggtgatgaaatccag
ctgaccgactcaatcgctatgctgatggagaaagagacggtagaagcttatcacctgaag
ggtgccagccatgactgtggtaacaagctcggctatatgcaggctttcgttgaatatggt
gtgcgtcacgaaaccctgggcagcgatttcaaagcttggctcgaaagcgctgtgggtaac
aaaaagtaa

DBGET integrated database retrieval system