KEGG   Erwinia sp. Ejp617: EJP617_30630Help
Entry
EJP617_30630      CDS       T01935                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
erj  Erwinia sp. Ejp617
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EJP617_30630 (pncA)
Enzymes [BR:erj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     EJP617_30630 (pncA)
    3.5.1.-  
     EJP617_30630 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3317604..3318218
Genome map
AA seq 204 aa AA seqDB search
MSIRQALLLIDLQNDFCPGGALAVSEGDQTIAVANRLAAEFQRRGEAVIATLDWHPAGHG
SFASNAGTIVGTLGDLNGLPQIWWPDHCVQHSHGAQLHPLLDRAAISLLVHKGENAEIDS
YSAFYDNGQRHQTLLHGWLREHGITALTVMGLATDYCVKFSVLGALALGYRVTVVTAGCR
GVNLHPDDSDNALLSMAQAGAILI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcatacgtcaggcactgttattgatagacctgcaaaatgacttttgtcccggcggg
gcgttggccgtcagcgaaggggatcagaccattgccgtcgctaaccgccttgctgccgaa
ttccagcggcgtggcgaggcggtgatcgccaccctcgactggcatcctgcagggcatggc
agttttgcctccaacgccgggacaatagtgggaaccctgggcgatttaaacggcttaccc
cagatctggtggccggatcattgcgtgcagcatagccacggtgcgcagctgcatcctttg
ctcgatcgcgcggcaatcagcctgctggtgcacaaaggtgagaatgcagaaattgatagc
tacagtgcattttatgataatggccagcgccatcagacgctgttacacggctggctgcgt
gagcatggcattactgccctgaccgtaatgggcctggcgaccgattactgcgtgaaattt
agcgtgctgggcgcactggctctgggctaccgggtgacggtggtgacagcaggctgccgg
ggcgttaatctgcatcctgacgacagtgacaatgccctgctatctatggctcaggcaggt
gcgatcctcatttaa

DBGET integrated database retrieval system