KEGG   Erwinia sp. Ejp617: EJP617_31780Help
Entry
EJP617_31780      CDS       T01935                                 

Gene name
hemB
Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
erj  Erwinia sp. Ejp617
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EJP617_31780 (hemB)
Enzymes [BR:erj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     EJP617_31780 (hemB)
Exosome [BR:erj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EJP617_31780 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3438701..3439810)
Genome map
AA seq 369 aa AA seqDB search
MPPGAAIHAERLSSDTLGYTVSTRFISSSPGPIPGGCPAKKEVVLSSYSPIQRPRRLRHS
ASLRSLFQENTLSLNDLALPIFVEEGLDDYKPIAAMPGVMRIPEKRLAYEIERIAKAGVR
SVMTFGISHHTDADGSDTWNENGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCGVLH
DHGVDNDATLKNLGRQAVVAAAAGADFIAPSAAMDGQVAAIRHALDVAGFTDTAIMSYST
KFASSFYGPFREAAGTSLKGDRKTYQMNPMNRREAIRESLIDEAEGADALMVKPAGAYLD
ILREVRDRTQLPLAAYQVSGEYAMIKFGAQAGAISETEVVLESLGAIKRAGADIIFSYFA
LDLAEKNIL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccaggggcggcaattcatgctgaaagattgtcatctgataccctggggtatact
gttagcacacgatttatttcatcatcaccggggccgatacccggtggatgccccgctaaa
aaagaggttgttttgtccagctattctcctatccagcgtccacgacgcctgcgtcattcc
gcttctcttcgctctctgtttcaggaaaacaccctcagtctgaacgatctggcgctgccg
atctttgttgaggaaggccttgacgactataagccgattgctgccatgccgggggtgatg
cgcattccggaaaagcgcctggcgtatgagattgaacgtattgccaaagcgggcgtgcgg
tcggtgatgaccttcggtatttctcaccataccgatgctgacggcagcgatacctggaac
gagaacgggctggtggcgcgtatgtcacgtatttgcaaacagacggtgccggaaatgatt
gtgatgtccgatacctgtttttgtgagtataccagccacggccactgcggcgtgctgcat
gaccacggcgtggataatgacgccacgctaaaaaaccttggcaggcaggcggtggtggcc
gccgcagcaggggctgattttatcgcgccgtcggcggcaatggacggtcaggtggcggcg
atccgtcacgcgctggatgtggctggctttaccgataccgccatcatgtcctattccacc
aagttcgcctcctccttctacggcccgttccgcgaagcggcaggcacctcgctgaaaggc
gatcgcaaaacctaccagatgaatccgatgaaccgccgcgaagcgattcgtgaatcgctg
atcgacgaagcggaaggggcggatgcgctgatggttaaaccggcgggtgcctatctggat
attctgcgcgaagtacgtgaccgcacccaactgccgctggcggcctatcaggtgagcggt
gagtacgcgatgattaagttcggtgcgcaggcgggtgccattagcgaaaccgaagtggtg
ctggaaagcctgggggcgatcaaacgcgccggtgccgatattattttcagctactttgct
cttgacctcgccgagaagaatattctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system