KEGG   Erwinia sp. Ejp617: EJP617_32990Help
Entry
EJP617_32990      CDS       T01935                                 

Gene name
galF
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00040  Pentose and glucuronate interconversions
erj00052  Galactose metabolism
erj00500  Starch and sucrose metabolism
erj00520  Amino sugar and nucleotide sugar metabolism
erj01100  Metabolic pathways
erj01130  Biosynthesis of antibiotics
Module
erj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EJP617_32990 (galF)
   00052 Galactose metabolism
    EJP617_32990 (galF)
   00500 Starch and sucrose metabolism
    EJP617_32990 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EJP617_32990 (galF)
Enzymes [BR:erj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EJP617_32990 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 PvlArgDC
Motif
Other DBs
NCBI-ProteinID: ADP12980
UniProt: E3DJ43
Position
complement(3558677..3559573)
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHLLPATKAIPKEMLPIVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTSYELEALLEARVKRSLLSEVKSICPPGVTIMNVRQPQPLGLADALLCARPM
LHDQAFVVVLPDVLLDNASADPLRYNLAAMVARFEETGRSQVLAHHMPEADLSEYSVITT
EESLDFPGKVSSILDFVEKPENPEVLNSDLAAVGRYVLSADIWPELEALEPGAWGRYQLT
DAIASLNKKTPVDAQLLSGDSFDCGRKLGYMKAFVTWGLRNHSQGREFRDEIQKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctgaaagcagttataccggttgcgggtctcggaatgcatctgctccctgcc
acaaaagctattcctaaagagatgttgcccatagtcgataagccaatgatccaatacatc
atcgatgaatgcgtggcggcgggtattaaggaaatcgttctggtcacccatgcatccaag
aatgcggttgaaaaccattttgatacttcctatgaactggaagccttgcttgaagcccgc
gttaaacgctccctgctgagcgaggtaaaatcgatctgcccaccaggtgtaacgattatg
aacgtgcgccaaccccagccgctggggcttgccgatgctttgctgtgcgcccgtcccatg
ctgcatgatcaagcgtttgtggtggtgctgcctgatgtgctgctggataatgccagcgcc
gatccgttgcgctacaacctggcggcgatggtagcacgttttgaagaaaccggacgtagc
caggtgctggctcatcatatgccggaagccgatctttcagagtactccgtgattaccacc
gaggagtcactggacttcccaggtaaagtcagttccattctggatttcgttgaaaaaccc
gaaaaccctgaggtgctaaattcggatctcgccgctgtggggcgctatgtgttatctgcc
gatatctggcccgagctggaagcgctggagccgggtgcatgggggcgctaccagctaact
gatgccatcgccagcttaaacaagaaaacgccggttgatgctcaattgcttagtggagat
agctttgactgtggacgtaagcttggttatatgaaagccttcgttacctggggcttgcgt
aaccatagtcaggggcgtgagttccgcgacgagatccagaaaatcctggcgaaataa

DBGET integrated database retrieval system