KEGG   Erwinia sp. Ejp617: EJP617_34880Help
Entry
EJP617_34880      CDS       T01935                                 

Gene name
fadJ
Definition
(GenBank) Fatty acid oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00071  Fatty acid degradation
erj00280  Valine, leucine and isoleucine degradation
erj00281  Geraniol degradation
erj00310  Lysine degradation
erj00362  Benzoate degradation
erj00380  Tryptophan metabolism
erj00410  beta-Alanine metabolism
erj00640  Propanoate metabolism
erj00650  Butanoate metabolism
erj00903  Limonene and pinene degradation
erj00930  Caprolactam degradation
erj01040  Biosynthesis of unsaturated fatty acids
erj01100  Metabolic pathways
erj01110  Biosynthesis of secondary metabolites
erj01120  Microbial metabolism in diverse environments
erj01130  Biosynthesis of antibiotics
erj01200  Carbon metabolism
erj01212  Fatty acid metabolism
Module
erj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EJP617_34880 (fadJ)
   00650 Butanoate metabolism
    EJP617_34880 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EJP617_34880 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EJP617_34880 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EJP617_34880 (fadJ)
   00310 Lysine degradation
    EJP617_34880 (fadJ)
   00380 Tryptophan metabolism
    EJP617_34880 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EJP617_34880 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EJP617_34880 (fadJ)
   00281 Geraniol degradation
    EJP617_34880 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EJP617_34880 (fadJ)
   00930 Caprolactam degradation
    EJP617_34880 (fadJ)
Enzymes [BR:erj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EJP617_34880 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EJP617_34880 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EJP617_34880 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DVL
Motif
Other DBs
NCBI-ProteinID: ADP13169
UniProt: E3DKX5
Position
complement(3771958..3774105)
Genome map
AA seq 715 aa AA seqDB search
MDLPSALTLTLRPDRVGVITIDVPYEKVNTLKAEFAADILALVQQARANPHLAGLVLISG
KPDSFIAGADINMIAVCHNTQQATALAQAGQKAMAEIAALPFPVVAAIHGACLGGGLELA
LACHRRICTQDDKTRFGLPEVQLGLLPGSGGTQRLPGVTGIRVALDMILTGKTLGARAAL
RCGLVDETVDHAILLEAAVQRVLQPLAAAKPLPLSERLLTRAPGRSLLFMLAQRRTRSKT
HGNYPATEKILSVVRCGLTPGSNGYLAEAQAFGELVMTPQSAALRSLFFANTALKKAHFG
VEPHELKRIGVLGGGLMGGGIACVTATRAGLPVRIKDVNANGINHALKTSWQALTRAVER
RRLSAAQRQQQMALITGSTDYQGFRQCDMVIEAVFEDLALKQKMVAEIEANCSVQTLFAS
NTSSLPIADIAAAAQRPENVIGLHYFSPPEKMPLVEVIPHAGTSRETLATAVMLARKQGK
TPIVVADRAGFYVNRILAPYIIEALHCLLEGEPVEYIDRSLVQFGFPLGPLQLLDEVGLD
VGTQIMPILQHAWGERFALPAGLEALWQDGRKGRKNGRGFYLYQQKGRKKRVDSTLYRLL
PVKVKQHLSAAHIAQRCVMMLLNEAARTLDEQGIASARDGDIGAVLGIGFPPFLGGPFRY
MDQLGIGEVVNRLTLLMQQHGSRFAPCSLLEKMAVEGKTFYQSDVKSDKLADSAG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccatctgcattgactcttactctgcgcccggatcgggtcggcgtcatcacc
atcgatgtaccgtatgagaaggttaacaccctgaaagctgaatttgccgcagatattctg
gcgcttgtccagcaggcgcgggcgaaccctcatctggccgggctggtactgatttccggt
aagcccgacagctttatcgccggggcagatatcaacatgatcgccgtctgtcacaataca
cagcaggcgaccgcattggctcaggccgggcaaaaggcgatggcggagatagccgcactg
ccgtttccggtcgtcgcggcgatccacggtgcctgccttggcggcgggcttgaactggcg
ctggcctgccatcgccgcatctgtacgcaggatgacaaaacccggtttggcttaccggaa
gttcagctgggcctgctgccgggttccggcgggacgcagcgcctgccgggcgtgacgggc
atccgggtggcactggatatgatattgactggcaaaacgctgggggcgcgcgccgcatta
cgctgcgggctggtggacgagacggtggatcacgccattctgctggaagcggcggtacag
cgggtgctacaaccgcttgcggcagcgaagcctttaccccttagcgaacggctgttaacc
cgcgcgcccggccgctcgctgctgtttatgctcgcacagcgccggacccggtcgaaaacc
cacggcaactatccggcgacggaaaaaattctcagcgtggtgcgctgcgggctgacgcca
ggcagcaacggctatttagccgaagcacaggcctttggtgaactggtgatgaccccgcag
tctgccgcgctgcgcagcctgttttttgccaacactgcgctaaaaaaagcgcattttggt
gttgaaccccatgaactgaaacgcattggcgtactgggcggtggcctgatgggcgggggg
attgcctgcgttactgcgacgcgtgccgggttgccggtgcgcatcaaagacgtcaatgcc
aacggcattaaccatgcgctgaaaaccagctggcaggcgctgacccgcgcggtggagcgc
cgccgcctgagtgcggcacagcgccagcagcagatggcattaatcaccggcagcaccgat
tatcagggcttccggcagtgcgatatggtcatcgaagcggtatttgaagacctggcgctg
aagcagaaaatggtggctgaaatcgaagcgaactgtagcgtacaaacgctgtttgcctcc
aatacctcttcgttgccgatagcggatattgccgccgccgcgcagcggccagagaacgtt
atcggcctgcattacttcagcccaccggagaaaatgccgctggtggaggtgatcccgcat
gcgggcacctccagagaaaccctcgccacagcggtgatgctggcacgaaaacagggcaag
acgccaatcgtcgtcgccgaccgggcgggcttctacgttaaccgtattcttgccccctat
attatcgaagcgctgcactgcctgctggagggggagccggttgaatatatcgaccggtcg
ctggtgcagttcggtttcccgcttggcccgttacagctgctggacgaggtcgggctggat
gtgggtacacagattatgccgatccttcaacatgcatggggcgaacgtttcgcgctgcca
gcgggactggaagcgctatggcaggatgggcgcaaaggacggaaaaacgggcgcgggttc
tatttgtatcaacagaaaggcagaaaaaaacgcgtcgacagcacgctgtaccgcctgctg
cccgtcaaggtaaaacagcatcttagcgcggcgcatatcgcccaacgctgtgtgatgatg
ttgttgaatgaggcagcacgaacgctggatgagcaggggatcgccagcgcgcgcgatggt
gatatcggcgcggtattgggcattggctttccgccttttcttggtgggccgttccgctat
atggaccagttgggtatcggtgaagtggtcaatcgtttaacgctgcttatgcagcagcac
ggttcacgttttgcgccttgttcactgctggaaaaaatggcggttgaaggcaaaaccttt
tatcaaagcgatgttaaatctgacaaactcgccgattcagctggttag

DBGET integrated database retrieval system