KEGG   Erysipelothrix larvae: AOC36_02430Help
Entry
AOC36_02430       CDS       T04263                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
erl  Erysipelothrix larvae
Pathway
erl00071  Fatty acid degradation
erl00072  Synthesis and degradation of ketone bodies
erl00280  Valine, leucine and isoleucine degradation
erl00310  Lysine degradation
erl00362  Benzoate degradation
erl00380  Tryptophan metabolism
erl00620  Pyruvate metabolism
erl00630  Glyoxylate and dicarboxylate metabolism
erl00640  Propanoate metabolism
erl00650  Butanoate metabolism
erl00900  Terpenoid backbone biosynthesis
erl01100  Metabolic pathways
erl01110  Biosynthesis of secondary metabolites
erl01120  Microbial metabolism in diverse environments
erl01130  Biosynthesis of antibiotics
erl01200  Carbon metabolism
erl01212  Fatty acid metabolism
erl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:erl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOC36_02430
   00630 Glyoxylate and dicarboxylate metabolism
    AOC36_02430
   00640 Propanoate metabolism
    AOC36_02430
   00650 Butanoate metabolism
    AOC36_02430
  Lipid metabolism
   00071 Fatty acid degradation
    AOC36_02430
   00072 Synthesis and degradation of ketone bodies
    AOC36_02430
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOC36_02430
   00310 Lysine degradation
    AOC36_02430
   00380 Tryptophan metabolism
    AOC36_02430
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOC36_02430
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOC36_02430
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AOC36_02430
Enzymes [BR:erl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOC36_02430
Exosome [BR:erl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOC36_02430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt L_biotic_typeA DUF4975
Motif
Other DBs
NCBI-ProteinID: AMC92879
UniProt: A0A0X8GZ22
Position
533252..534460
Genome map
AA seq 402 aa AA seqDB search
MKQDVYIIAAQRTAIGSYLGAFKDVSPARLGADIIKDILNKTQLNPKNIDEVIVGNVLSP
GQGQGLARQVSILGGIPFEVPAYAINMVCGSGLKAVMNGVDAISNASAHLVFAGGVESMS
QAPYLVSHKTRSGHKMGDLTMVDAMIHDALTDAFDHTHMGITAENIAQSYAITREAQDAF
AMHSQEKAINAIDAGVFRDEITPVTISTRNGDVVVDVDEYPNRNTSMAKLAKLRPAFKKE
GTVTAGNASGINDGASFVLLSDQETLDKTSIQPLARIVSMGQGGVDPKMMGMGPVPAINQ
ALMRANLSLQDIDVLELNEAFAAQSLGVIQTLSETYNISTQELMDKTNIHGGAIALGHPV
GASGNRILVTLTHELKRSQKRYGLASLCIGGGMGVAIIIESV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggatgtttatatcattgcagcacaacgcactgcaattggaagttatttaggt
gcatttaaagatgtttcgcccgcacgtttaggcgcggatattatcaaagatatactcaac
aagacccagctgaatccaaagaatatcgatgaagtaattgtggggaatgttttatcacca
ggccaaggtcaaggcttagcacggcaagtgtctattttgggaggaattccctttgaggta
cctgcatatgcgattaatatggtctgtggatcgggattaaaagcggtgatgaatggtgtc
gatgcgatttcaaatgcatccgcacaccttgttttcgcaggaggagttgaatccatgagt
caagccccatatcttgtatcccacaaaacccgaagtggtcataaaatgggtgatttgacg
atggtcgatgcaatgattcatgatgcacttaccgatgcctttgatcacacgcatatggga
atcactgcagaaaatattgcgcaaagttatgccatcacccgtgaagcacaagatgctttc
gcaatgcactcacaagaaaaagccatcaacgccattgatgcaggtgtctttcgtgatgaa
atcacacctgtcaccatctcaacacgaaacggggatgtggtggtcgatgtggatgaatat
cccaaccgtaatacttcaatggcgaaacttgcgaaattaagaccggcctttaaaaaggaa
ggaacggttactgctggtaatgcttcaggcattaatgatggggcaagttttgtcttactt
tctgatcaagaaacactggataagacatcaatacaacccctcgcgcggattgtttcaatg
ggacaagggggcgtggatcctaaaatgatgggtatgggtccagtacctgcaatcaaccaa
gcgcttatgcgtgcaaatctgtcgttacaggatattgatgtgttggaattgaatgaagcc
tttgcagcccaatcattgggtgtgattcaaacactcagtgagacgtataatatttcaact
caagaattaatggacaagacaaacatccatgggggtgcaattgctcttgggcatccggtg
ggtgccagtggtaatcgcatcttagtgaccctgacacatgaacttaaacgcagtcaaaag
cggtatgggttggcatccttgtgtattgggggtggcatgggcgtcgcaataatcattgaa
agtgtctaa

DBGET integrated database retrieval system