KEGG   Erysipelothrix rhusiopathiae SY1027: K210_05085Help
Entry
K210_05085        CDS       T02688                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ers  Erysipelothrix rhusiopathiae SY1027
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ers00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    K210_05085
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    K210_05085
   00620 Pyruvate metabolism
    K210_05085
   00650 Butanoate metabolism
    K210_05085
  Lipid metabolism
   00071 Fatty acid degradation
    K210_05085
  Amino acid metabolism
   00350 Tyrosine metabolism
    K210_05085
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    K210_05085
   00626 Naphthalene degradation
    K210_05085
Enzymes [BR:ers01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     K210_05085
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     K210_05085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(927427..928626)
Genome map
AA seq 399 aa AA seqDB search
MRDVERVFVVTDRAMVDLGYYNLIVEQLNKRRNKVQIQLFCDVEPDPSLNTVKRGYEMMK
SFQPDTIIALGGGSPMDAAKGMWIFYEHPDVDFNDLKQKFVDIRKRAFRYPDLGEKAQLV
CIPTTSGTGSEVTPFAVITDTDANKKYPLADYSLVPTVAIVDPIFTTNLPASVTADTGLD
VLTHATEAYVSNFANDYTDGLAIQAIKMVFENLERAVYNGKNDLDAREKMHNASTLAGMA
FANAFLGMSHSLAHKIGGKFHEMPHGRINAILLPYVVRYNGTHPEKPSLWPKYNVYRAHE
RYAELARILGLPASTTEEGVESYAQACHDLAVRCGIKMSFQEQGVNEKAFMAETETIAYL
AYEDQCSPCNPRLPLVKDMKAIIEHAYYPAGKIPTKSKK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgttgaacgtgtattcgttgtaacagaccgtgcgatggttgatttaggttac
tacaacttaattgttgaacaacttaataaacgtcgtaacaaagttcaaattcaattattc
tgtgatgttgagccagatccatcattaaacaccgttaaacgtggttatgaaatgatgaaa
tcattccaacctgatacaattattgctttaggtggtggttcaccgatggatgccgctaaa
ggtatgtggatcttctacgaacatccagatgtagactttaatgatttaaaacaaaaattt
gtggatatccgtaaacgtgcattccgttacccagacttgggcgaaaaagcacaacttgta
tgtatcccaacaacttccggtaccggtagtgaggttacaccatttgcagttatcactgat
acagatgcaaataagaaatacccacttgctgactactcacttgttccaactgttgcgatt
gttgatccaatcttcacaactaaccttcctgcttcagtaactgcagatacaggtcttgat
gtgttaacacatgctacagaagcatatgtttcaaacttcgcaaatgactatacagatggt
cttgcaatccaagccattaaaatggtttttgaaaaccttgaacgtgcagtatataacggt
aaaaatgacttggatgcacgtgaaaaaatgcataatgcttcaactcttgcagggatggca
tttgcgaatgcattcttaggtatgagtcactcattagcgcataaaattggtgggaaattc
cacgaaatgcctcatggacgtattaatgcaattctcttaccatatgttgtacgttataat
ggtacacatccagaaaaaccttcattatggccaaaatacaatgtataccgtgcacatgaa
cgttatgctgaattagctcgtatcctcggattaccagcaagcacaactgaagaaggtgtt
gaaagttatgctcaagcatgtcatgacttagcagtacgttgtggtattaagatgagtttc
caagaacaaggtgtaaatgaaaaagcatttatggctgaaacagaaaccattgcttatctt
gcatatgaagaccaatgttcaccatgtaacccacgtcttccacttgttaaggatatgaaa
gcaatcattgaacatgcttactatcctgcaggaaaaattcctacaaaatcaaaaaaataa

DBGET integrated database retrieval system